Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

Slides:

Advertisements

Similar presentations

AB 11 22 33 44 55 66 77 88 99 10  20  19  18  17  16  15  14  13  12  11  21  22  23  24  25  26  27  28.

Advertisements

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Figure 1.1 The observer in the truck sees the ball move in a vertical path when thrown upward. (b) The Earth observer views the path of the ball as a parabola.

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

CHARACTERS USED IN RECONSTRUCTING PHYLOGENETIC TREES 1. Morphological “ Tiktaalik is the sister group of Acanthostega + Ichthyostega in one of the two.

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

Laura McCoy.  rRNA genes are a multi-gene family  Located in the nucleolus of the cell  Genes are found in tandem arrays  rRNA plus ribosomal proteins.

MB-PO13 T S. graminisoli NBRC T S. shenzhenensis DSM T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

From: On the Origin of Darwin's Finches

(BPL-1, BD, BP, BC, BSP1, BSP4, Bsa-2)

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

History of Lactobacillus acidophilus

Fig.1. Dendrogram depicting NJ/ML/MP trees constructed using –MEGA 6

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

The Effect of Oxygen (O2) on Growth

Office hours aplenty...

NCBI - Nucleotide collection (nr/nt) Affiliation Closest Match

Mycoplasma pneumoniae—an emerging extra-pulmonary pathogen

Molecular Evolution.

Skin microbiota is the main reservoir of Roseomonas mucosa, an emerging opportunistic pathogen so far assumed to be environmental S. Romano-Bertrand,

Zika virus genome from the Americas

Clinical Microbiology and Infection

3-I 3 3-II Farm S1-25f swine (AY858911) Mexico

Evaluation of antimicrobial properties and their substances against pathogenic bacteria in-vitro by probiotic Lactobacilli strains isolated from commercial.

F. Aujoulat, H. Marchandin, I. Zorgniotti, A. Masnou, E. Jumas-Bilak

(30% amylopectin, high amylose)

Phenotypic Plasticity: Different Teeth for Different Feasts

Molecular epidemiology of clinical Acinetobacter baumannii and Acinetobacter genomic species 13TU isolates using a multilocus sequencing typing scheme

What is a cladogram?.

F. Magurano Clinical Microbiology and Infection

Microbial classification

C. O'Driscoll, J. Konjek, B. Heym, M. M. Fitzgibbon, B. J. Plant, M

A. Papa, K. Xanthopoulou, S. Gewehr, S. Mourelatos

Identification and pathogenicity analysis of a novel non-tuberculous mycobacterium clinical isolate with nine-antibiotic resistance Z.-Y. Zhang, Z.-Q.

(a) Subtree of the MetaPalette output tree for the Iowa prairie metagenome using organisms from the genus Bradyrhizobium. (a) Subtree of the MetaPalette.

The oral cavity as a natural reservoir for Streptococcus sinensis

Whole genome-based phylogenetic analysis of Rickettsiae

Species of Metarhizium anisopliae complex implicated in human infections: retrospective sequencing study C. Nourrisson, D. Dupont, R.-A. Lavergne, J.

Development of a real-time PCR assay for the specific detection and identification of Streptococcus pseudopneumoniae using the recA gene V. Sistek, M.

Evaluation of matrix-assisted laser desorption ionization-time of flight mass spectrometry for species identification of Acinetobacter strains isolated.

MW polyomavirus and STL polyomavirus present in tonsillar tissues from children with chronic tonsillar disease J. Peng, K. Li, C. Zhang, Q. Jin Clinical.

Features of the Protein Encoded by the Ruby Transcript

Phylogenetic tree based on 16S rRNA gene sequence comparisons over 1,260 aligned bases showing the relationship between species of the genus Actinomyces.

Phylogenetic tree constructed by the neighbor-joining method, showing the position of Peptostreptococcus species within Clostridium rRNA clusters XI, XIII,

Complete nucleotide sequence analysis of the VP1 genomic region of Echoviruses 6 isolated from sewage in Greece revealed 98% similarity with Echoviruses.

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

Evolutionary relationships between sporadic and epidemic strains of healthcare- associated methicillin-resistant Staphylococcus aureus M. Hallin, O. Denis,

K. S. Ko, T. Kuwahara, L. Haehwa, Y. -J. Yoon, B. -J. Kim, K. -H

Figure 1. The unique structures of the SCCmec type II element identified in ORSL strain CGMH-SL Figure 1. The unique structures of the SCCmec type.

Prolonged outbreak of human parainfluenza virus 3 infection in a stem cell transplant outpatient department: insights from molecular epidemiologic analysis

Actinotignum schaalii (formerly Actinobaculum schaalii): a newly recognized pathogen— review of the literature R. Lotte, L. Lotte, R. Ruimy Clinical.

Phylogenetic comparison among selected Pasteurella multocida and Haemophilus influenzae species with completed genome sequences. Phylogenetic comparison.

Neighbor-joining distance tree based on Hsp90 sequences indicating that the cytosolic and ER resident forms of these protein form paralogous gene families,

(a) Mycetoma aspect of the patient in the right forearm.

Year 10, Pathway C 2012 New Generations.

Novel West Nile virus lineage 1a full genome sequences from human cases of infection in north-eastern Italy, 2011 L. Barzon Clinical Microbiology and.

Schematic depiction of representative sequences from enterobacterial plasmids, showing the association of carbapenemase-encoding genes with various mobile.

Dendrogram of the genus Serratia, constructed using the neighbor-joining method in MicroSeq software. 16S rRNA gene sequences of type strains of the species,

Synteny and Phylogeny of Putative GRMZM2G Orthologs.

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

(A) Comparison of mcr-9 to all previously described mcr homologues, based on amino acid sequence. (A) Comparison of mcr-9 to all previously described mcr.

Phylogenetic trees of S. oralis and S. mitis strains.

Relationship of partial rpoB gene sequences inferred by the neighbor-joining method for Canadian study strains of C. pyruviciproducens. Relationship of.

Dendrogram relationships by 16S rRNA gene similarity of the A

Genotypic and phenotypic characterization of yeast strains isolated from ancient vessels. Genotypic and phenotypic characterization of yeast strains isolated.

Tree depicting the phylogenetic relationships of all strains included in this study. Tree depicting the phylogenetic relationships of all strains included.

16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts. 16S rRNA-based phylogeny of sponge-associated cyanobacteria and chloroplasts.

(A and B) Maximum-likelihood trees of 28 strains of Pantoea agglomerans and closely related species, constructed using concatenated sequences of six protein-coding.

Presentation transcript:

Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar at 25 ℃ for 24 h.

Sphingobacterium arenae H-12T (KC193325) Sphingobacterium thermophilum CKTN2T (AB563783) Sphingobacterium wenxiniae LQY-18T (GQ988781) Sphingobacterium composti 4M24T (EF122436) Sphingobacterium lactis DSM 22361T (FN908501) Sphingobacterium mizutaii DSM 11724T (AJ438175) Sphingobacterium daejeonense TR6-04T (AB249372) Sphingobacterium kyonggiense KEMC 2241-005T (GU358699) Sphingobacterium bambusae IBFC2009T (GQ339910) Sphingobacterium hotanense XH4T (FJ859899) Sphingobacterium shayense HS39T (FJ816788) Sphingobacterium psychroaquaticum MOL-1T (FJ156081) Sphingobacterium alimentarium DSM 22362T (FN908502) Sphingobacterium composti T5-12T (AB244764) Sphingobacterium nematocida M-SX103T (JF731241) Sphingobacterium yamdrokense 3-0-1T (KC904977) Sphingobacterium spiritivorum NCTC 11386T (EF090267) Sphingobacterium anhuiense CW 186T (EU364817) Sphingobacterium kitahiroshimense 10CT (AB361248) Sphingobacterium faecium DSM 11690T (AJ438176) Sphingobacterium thalpophilum DSM 11723T (AJ438177) Sphingobacterium changzhouense N7T (KC843944) Sphingobacterium canadense CR11T (AY787820) Sphingobacterium ginsenosidimutans THG 07T (GU138378) Sphingobacterium detergens 6.2ST (JN015213) Sphingobacterium caeni DC-8T (JX046042) Sphingobacterium multivorum B5533T (AB100738) Sphingobacterium cladoniae No.6T (FJ868219) Sphingobacterium siyangense SY1T (EU046272) Sphingobacterium heparinum ATCC 13125T (M11657) Sphingobacterium antarcticum 4BYT (HM448033) Sphingobacterium piscium DSM 11725T (AJ438174) Blastomonas natatoria EY 4220T (AB024288) 98 100 77 82 93 70 75 51 81 69 60 73 99 50 Fig. S2 The maximum-parsimony tree based on 16S rRNA gene sequence analysis, showing the relationships between strain 3-0-1T and other species of the genus Sphingobacterium. Bootstrap values were based on 1,000 replications and percentages (above 50 %) are given.