Presentation is loading. Please wait.

Presentation is loading. Please wait.

MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

Published byDrusilla Lester Modified over 8 years ago

Similar presentations

Presentation on theme: "MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces."— Presentation transcript:

1 MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces species on ISP 2 agar plate after incubation at 28 ° C for 7 days. S. gramineus NBRC 108885 T S. rhizophilus NBRC 107863 T

2 hyaluromycin MB-PO13 T S. shenzhenensis DSM 40343 T S. graminisoli NBRC 108883 T Column: COSMOSIL 5C18-AR-II (4.6 × 250 mm) Solvent: MeCN / 0.1% HCO 2 H Flow: 1.0 mL/min Detector: 254 nm Fig. S2. HPLC chromatogram of BuOH extracts of strain MB-PO13 T and related Streptomyces species cultured in yeast extract-starch liquid medium at 28 ° C for 7 days. MeCN concentration was 15%–85% for 0–30 min.

3 Fig. S3. Maximum-likelihood phylogenetic tree based on 16S rRNA gene sequences of strain MB-PO13 T and its taxonomic neighbours. Kitasatospora setae KM-6054 T (AB022868) was used as the outgroup. Bootstrap values (>70%) based on 1,000 replicates are shown at branch nodes. S. tricolor LMG 20328 T (AJ781380) S. bangladeshensis AAB-4 T (AY750056) S. chiangmaiensis TA4-1 T (AB562507) S. mutabilis C.B.239 T (KF991631) S. rochei SM3 T (JN128892) S. minutiscleroticus NRRL B-12202 T (EF178696) S. hyaluromycini MB-PO13 T (AB184533) S. graminisoli JR-12 T (HQ267994) S. shenzhenensis 172115 T (HQ660226) S. jiujiangensis JXJ 0074 T (KF938657) S. niveoruber MA1 T (JF827351) S. murinus MDMT-5 T (KF973308) S. rhizophilus JR-41 T (HQ267989) S. gramineus JR-43 T (NR 109017) S. katrae NRRL B-3093 T (EF654092) S. lavendulae IFO 3125 T (D85106) S. galbus DSM 40089 T (NR 026178) S. capoamus JCM 4734 T (NR 040856) S. hygroscopicus subsp. limoneus ATCC 21431 T (X79853) S. hawaiiensis NRRL 15010 T (EU624140) S. tumescens OTP-3-1 T (AF346484) Kitasatospora. setae KM-6054 T (AB022868) 100 99 90 80 99 85 91 72 0.01

4 Fig. S4. Maximum-parsimony phylogenetic tree based on 16S rRNA gene sequences of strain MB-PO13 T and its taxonomic neighbours. Kitasatospora setae KM-6054 T (AB022868) was used as the outgroup. Bootstrap values (>70%) based on 1,000 replicates are shown at branch nodes. S. jiujiangensis JXJ 0074 T (KF938657) S. niveoruber MA1 T (JF827351) S. murinus MDMT-5 T (KF973308) S. shenzhenensis 172115 T (HQ660226) S. hyaluromycini MB-PO13 T (AB184533) S. graminisoli JR-12 T (HQ267994) S. tricolor LMG 20328 T (AJ781380) S. bangladeshensis AAB-4 T (AY750056) S. chiangmaiensis TA4-1 T (AB562507) S. mutabilis C.B.239 T (KF991631) S. rochei SM3 T (JN128892) S. minutiscleroticus NRRL B-12202 T (EF178696) S. rhizophilus JR-41 T (HQ267989) S. gramineus JR-43 T (NR 109017) S. katrae NRRL B-3093 T (EF654092) S. lavendulae IFO 3125 T (D85106) S. capoamus JCM 4734 T (NR 040856) S. galbus DSM 40089 T (NR 026178) S. hygroscopicus subsp. limoneus ATCC 21431 T (X79853) S. hawaiiensis NRRL 15010 T (EU624140) S. tumescens OTP-3-1 T (AF346484) Kitasatospora setae KM-6054 T (AB022868) 100 95 88 99 81

5 DPG PI PE PL6 PL5 PL1 PL2 PL4 PL3 Fig. S5. Two-dimensional thin-layer chromatogram of polar lipids from strain MB- PO13 T Abbreviations: DPG, diphosphatidylglycerol; PE, phosphatidylethanolamine; PI, phosphatidylinositol; PL1–PL6, unidentified polar lipids. The spray reagent, 5% molybdophosphoric acid. 1st 2nd

6 Table S1. Cellular fatty acid composition (%) of strain MB-PO13 T and related Streptomyces species. Strains: 1, strain MB-PO13 T ; 2, S. graminisoli NBRC 18883 T ; 3, S. shenzhenensis DSM 42034 T ; 4, S. rhizophilus NBRC 108885 T ; 5, S. gramineus NBRC 107863 T ; 6, S. jiujiangensis JXJ 0074 T. The analyses of 1 to 5 were performed in parallel in this study. Data of 6 are from Zhang et al. 31 Bold type shows the major components (>10%). –, Not detected; tr, traces (<1%); ND, no data. Fatty acid123456 Saturated fatty acids Straight-chain C 12:0 ––––trND C 13:0 ––tr ND C 14:0 tr1.4tr 1.5ND C 15:0 2.64.35.2––ND C 16:0 10.78.76.16.59.2ND C 17:0 tr 1.0tr ND Branched iso-C 12:0 tr – ND iso-C 13:0 tr ND iso-C 14:0 15.09.18.210.810.32.6 iso-C 15:0 8.98.611.49.713.54.3 iso-C 16:0 23.424.121.632.621.217.7 iso-C 17:0 2.41.32.61.82.2ND anteiso-C 13:0 tr ND anteiso-C 15:0 24.925.727.725.731.643.6 anteiso-C 17:0 5.65.76.64.34.815.8 Cyclic cyclohexyl-C 17:0 1.1tr ND Mono-unsaturated fatty acids C 15:1 B–tr–––ND iso-C 16:1 Htr1.51.31.5tr3.8 C 16:1 ω9c1.13.41.8–ND C 17:1 ω8c–––tr ND C 17:1 ω9c–tr ––ND iso-C 17:1 ω9c–––1.0trND anteiso-C 17:1 Ctr1.21.6––ND anteiso-C 17:1 ω9c–––tr 6.7 9-Methyl fatty acid 9-Methyl C 16:0 tr 1.7––ND

Download ppt "MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces."

Similar presentations

THIN LAYER CHROMATOGRAPHY. Thin layer chromatography (TLC) is a simple, inexpensive method which requires a minimum of instrumentation and can be used.

THIN LAYER CHROMATOGRAPHY. Thin layer chromatography (TLC) is a simple, inexpensive method which requires a minimum of instrumentation and can be used.
Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.
Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,
HPLC and SEM-EDX analysis

HPLC and SEM-EDX analysis
(a) (b) (c) (d) (e) (f) (g) Figure S1.. Figure S1. Comparison of OsPCR1-6 and GW2 transcript levels in the grains of developing gw2 and wild-type isogenic.

(a) (b) (c) (d) (e) (f) (g) Figure S1.. Figure S1. Comparison of OsPCR1-6 and GW2 transcript levels in the grains of developing gw2 and wild-type isogenic.
HPLC – High Performance Liquid Chromatography

HPLC – High Performance Liquid Chromatography
Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.
Lipid extractions [Quench with hot isopropanol and hexane] Heat stress at 42°C [0, 30, 60 min; at an Infors] Collect cells [Centrifuge at 1000 g for 2.

Lipid extractions [Quench with hot isopropanol and hexane] Heat stress at 42°C [0, 30, 60 min; at an Infors] Collect cells [Centrifuge at 1000 g for 2.
1tables and figures Supplementary Table 1 Genes potentially implicated in Medicago truncatula triterpenoid biosynthesis correlated with bAS NameProbeset.

1tables and figures Supplementary Table 1 Genes potentially implicated in Medicago truncatula triterpenoid biosynthesis correlated with bAS NameProbeset.
HPLC 1. Introduction 1.Introduction  INSTUMENTAL ANALYSIS  PRACTICAL 213 PHC  HPLC.

HPLC 1. Introduction 1.Introduction  INSTUMENTAL ANALYSIS  PRACTICAL 213 PHC  HPLC.
Production of biosurfactants from yeasts cultivated on glycerol A. Giannopoulos, A. Makri and G. Aggelis Unit of Microbiology, Division of Genetics; Cell.

Production of biosurfactants from yeasts cultivated on glycerol A. Giannopoulos, A. Makri and G. Aggelis Unit of Microbiology, Division of Genetics; Cell.
Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,

Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,
Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.

Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.
HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.

HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.
Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS 279.48 (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.
A B C Embryo L4 larvae AL DR TAG PC

A B C Embryo L4 larvae AL DR TAG PC
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Fig. 1. Locations of shelf station C3a and oceanic station S412.

Fig. 1. Locations of shelf station C3a and oceanic station S412.
Altered hepatic lipid status and apolipoprotein A-I metabolism in mice lacking phospholipid transfer protein  Sarah Siggins, Igor Bykov, Martin Hermansson,

Altered hepatic lipid status and apolipoprotein A-I metabolism in mice lacking phospholipid transfer protein  Sarah Siggins, Igor Bykov, Martin Hermansson,
M. Birkou, S. Bellou and G. Aggelis

M. Birkou, S. Bellou and G. Aggelis

Similar presentations

Ads by Google