MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

Slides:

Advertisements

Similar presentations

THIN LAYER CHROMATOGRAPHY. Thin layer chromatography (TLC) is a simple, inexpensive method which requires a minimum of instrumentation and can be used.

Advertisements

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

HPLC and SEM-EDX analysis

(a) (b) (c) (d) (e) (f) (g) Figure S1.. Figure S1. Comparison of OsPCR1-6 and GW2 transcript levels in the grains of developing gw2 and wild-type isogenic.

HPLC – High Performance Liquid Chromatography

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

Lipid extractions [Quench with hot isopropanol and hexane] Heat stress at 42°C [0, 30, 60 min; at an Infors] Collect cells [Centrifuge at 1000 g for 2.

1tables and figures Supplementary Table 1 Genes potentially implicated in Medicago truncatula triterpenoid biosynthesis correlated with bAS NameProbeset.

HPLC 1. Introduction 1.Introduction  INSTUMENTAL ANALYSIS  PRACTICAL 213 PHC  HPLC.

Production of biosurfactants from yeasts cultivated on glycerol A. Giannopoulos, A. Makri and G. Aggelis Unit of Microbiology, Division of Genetics; Cell.

Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,

Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.

HKT1 form Arabidopsis relative extremophile Thellungiella work as Na/K co-transporter.

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

A B C Embryo L4 larvae AL DR TAG PC

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Fig. 1. Locations of shelf station C3a and oceanic station S412.

Altered hepatic lipid status and apolipoprotein A-I metabolism in mice lacking phospholipid transfer protein Sarah Siggins, Igor Bykov, Martin Hermansson,

M. Birkou, S. Bellou and G. Aggelis

Isolation and characterization of a bacterial consortium capable to degrade the saturated fraction of the mineral oil. Giovanna Siracusa1, Simona Di Gregorio1,

Supplementary Fig. 2- Maximum likelihood phylogenetic trees drawn for the (a) VP1 gene of R2 strains, (b) VP2 gene of C2 strains, (c) VP3 gene of M2 strains,

Fig. 6. Characterization of the VvgGT protein product (p-hydroxybenzoyl-glucose) with p-hydroxybenzoic acid as substrate. (A) Chromatogram at 280 nm of.

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

Zika virus genome from the Americas

Fig. 3. Antimicrobial activity is detected in diverse strains of CoNS and not predictable at the species level. Antimicrobial activity is detected in diverse.

Volume 124, Issue 3, Pages (March 2003)

3-I 3 3-II Farm S1-25f swine (AY858911) Mexico

Volume 10, Issue 12, Pages (December 2003)

Phylogenetic relationships between representatives of the Bacteroidetes “Candidatus Amoebophilus” (based on 1,218 bp) and amplicon SSU rRNA gene sequences.

F. Magurano Clinical Microbiology and Infection

Hierarchical cluster analysis of reproducible parent masses (MS) representative of produced SMs from oral in vitro-grown biofilm representing >100 bacterial.

A Mouse Mutation in the 12R-Lipoxygenase, Alox12b, Disrupts Formation of the Epidermal Permeability Barrier Jennifer L. Moran, Haiyan Qiu, Annick Turbe-Doan,

Volume 24, Issue 6, Pages e7 (June 2017)

Ehrlichia canis phylogenetic analysis of the Borgo (Corsica) strain

C. O'Driscoll, J. Konjek, B. Heym, M. M. Fitzgibbon, B. J. Plant, M

A. Papa, K. Xanthopoulou, S. Gewehr, S. Mourelatos

Identification and pathogenicity analysis of a novel non-tuberculous mycobacterium clinical isolate with nine-antibiotic resistance Z.-Y. Zhang, Z.-Q.

Phylogenetic tree of perA A2-domain DNA sequence.

Detection of Wolbachia genes in a patient with non-Hodgkin's lymphoma

Hepatitis B virus in Buenos Aires, Argentina: genotypes, virological characteristics and clinical outcomes S.C. Pezzano, C. Torres, H.A. Fainboim, M.B.

Development of a real-time PCR assay for the specific detection and identification of Streptococcus pseudopneumoniae using the recA gene V. Sistek, M.

Outbreak of hand, foot and mouth disease/herpangina associated with coxsackievirus A6 and A10 infections in 2010, France: a large citywide, prospective.

MW polyomavirus and STL polyomavirus present in tonsillar tissues from children with chronic tonsillar disease J. Peng, K. Li, C. Zhang, Q. Jin Clinical.

Phylogenetic tree based on 16S rRNA gene sequence comparisons over 1,260 aligned bases showing the relationship between species of the genus Actinomyces.

Emergence of Crimean–Congo haemorrhagic fever in Greece

Phylogenetic tree of 38 Pseudomonas type strains, based on the V3-V5 region sequence of the 16S rRNA gene (V3 primer, positions 442 to 492; and V5 primer,

Proportion of 16S rRNA gene sequences in each category of phylogenetic novelty relative to cultures for each environment, by amplicons, metagenomes (without.

Fungi most closely related to A. gossypii.

K. S. Ko, T. Kuwahara, L. Haehwa, Y. -J. Yoon, B. -J. Kim, K. -H

T. A. Nguyen, L. P. Hoang, L. D. Pham, K. T. Hoang, S. Okitsu, M

Two cycad AOX genes, CrAOX1 and CrAOX2, showing different expression patterns in thermogenic male cones. Two cycad AOX genes, CrAOX1 and CrAOX2, showing.

TCRs bind to CD1b-PG complexes formed in cells.

Sandfly fever virus outbreak in Cyprus

Unrooted neighbour-joining phylogenetic tree based on the 5′UTR (5′ untranslated region) sequence among pestiviruses. Unrooted neighbour-joining phylogenetic.

Phylogenetic comparison among selected Pasteurella multocida and Haemophilus influenzae species with completed genome sequences. Phylogenetic comparison.

Lipid mass spectrometry analysis of WT, tgl3Δ and vps4Δ mutant cells.

Phylogenetic analysis of AquK2P.

Phylogenetic analysis of K. quasipneumoniae subsp

Bacterial composition of olive fermentations is affected by microbial inoculation. Bacterial composition of olive fermentations is affected by microbial.

Fig. 6. HPLC analysis of RP key components

Characterization of SsPV1/WF-1 isolated from hypovirulent strain WF-1.

Distance tree of ITS2 rRNA gene sequences of 54 strains belonging to species known as black-grain mycetoma agents. Distance tree of ITS2 rRNA gene sequences.

Phylogenetic tree based on predominant 16S rRNA gene sequences obtained by C4–V8 Sutterella PCR from AUT-GI patients, Sutterella species isolates, and.

Relationship of partial rpoB gene sequences inferred by the neighbor-joining method for Canadian study strains of C. pyruviciproducens. Relationship of.

A typical chromatogram of meropenem (retention time 2

Genotypic and phenotypic characterization of yeast strains isolated from ancient vessels. Genotypic and phenotypic characterization of yeast strains isolated.

Tree depicting the phylogenetic relationships of all strains included in this study. Tree depicting the phylogenetic relationships of all strains included.

(A and B) Maximum-likelihood trees of 28 strains of Pantoea agglomerans and closely related species, constructed using concatenated sequences of six protein-coding.

Presentation transcript:

MB-PO13 T S. graminisoli NBRC T S. shenzhenensis DSM T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces species on ISP 2 agar plate after incubation at 28 ° C for 7 days. S. gramineus NBRC T S. rhizophilus NBRC T

hyaluromycin MB-PO13 T S. shenzhenensis DSM T S. graminisoli NBRC T Column: COSMOSIL 5C18-AR-II (4.6 × 250 mm) Solvent: MeCN / 0.1% HCO 2 H Flow: 1.0 mL/min Detector: 254 nm Fig. S2. HPLC chromatogram of BuOH extracts of strain MB-PO13 T and related Streptomyces species cultured in yeast extract-starch liquid medium at 28 ° C for 7 days. MeCN concentration was 15%–85% for 0–30 min.

Fig. S3. Maximum-likelihood phylogenetic tree based on 16S rRNA gene sequences of strain MB-PO13 T and its taxonomic neighbours. Kitasatospora setae KM-6054 T (AB022868) was used as the outgroup. Bootstrap values (>70%) based on 1,000 replicates are shown at branch nodes. S. tricolor LMG T (AJ781380) S. bangladeshensis AAB-4 T (AY750056) S. chiangmaiensis TA4-1 T (AB562507) S. mutabilis C.B.239 T (KF991631) S. rochei SM3 T (JN128892) S. minutiscleroticus NRRL B T (EF178696) S. hyaluromycini MB-PO13 T (AB184533) S. graminisoli JR-12 T (HQ267994) S. shenzhenensis T (HQ660226) S. jiujiangensis JXJ 0074 T (KF938657) S. niveoruber MA1 T (JF827351) S. murinus MDMT-5 T (KF973308) S. rhizophilus JR-41 T (HQ267989) S. gramineus JR-43 T (NR ) S. katrae NRRL B-3093 T (EF654092) S. lavendulae IFO 3125 T (D85106) S. galbus DSM T (NR ) S. capoamus JCM 4734 T (NR ) S. hygroscopicus subsp. limoneus ATCC T (X79853) S. hawaiiensis NRRL T (EU624140) S. tumescens OTP-3-1 T (AF346484) Kitasatospora. setae KM-6054 T (AB022868)

Fig. S4. Maximum-parsimony phylogenetic tree based on 16S rRNA gene sequences of strain MB-PO13 T and its taxonomic neighbours. Kitasatospora setae KM-6054 T (AB022868) was used as the outgroup. Bootstrap values (>70%) based on 1,000 replicates are shown at branch nodes. S. jiujiangensis JXJ 0074 T (KF938657) S. niveoruber MA1 T (JF827351) S. murinus MDMT-5 T (KF973308) S. shenzhenensis T (HQ660226) S. hyaluromycini MB-PO13 T (AB184533) S. graminisoli JR-12 T (HQ267994) S. tricolor LMG T (AJ781380) S. bangladeshensis AAB-4 T (AY750056) S. chiangmaiensis TA4-1 T (AB562507) S. mutabilis C.B.239 T (KF991631) S. rochei SM3 T (JN128892) S. minutiscleroticus NRRL B T (EF178696) S. rhizophilus JR-41 T (HQ267989) S. gramineus JR-43 T (NR ) S. katrae NRRL B-3093 T (EF654092) S. lavendulae IFO 3125 T (D85106) S. capoamus JCM 4734 T (NR ) S. galbus DSM T (NR ) S. hygroscopicus subsp. limoneus ATCC T (X79853) S. hawaiiensis NRRL T (EU624140) S. tumescens OTP-3-1 T (AF346484) Kitasatospora setae KM-6054 T (AB022868)

DPG PI PE PL6 PL5 PL1 PL2 PL4 PL3 Fig. S5. Two-dimensional thin-layer chromatogram of polar lipids from strain MB- PO13 T Abbreviations: DPG, diphosphatidylglycerol; PE, phosphatidylethanolamine; PI, phosphatidylinositol; PL1–PL6, unidentified polar lipids. The spray reagent, 5% molybdophosphoric acid. 1st 2nd

Table S1. Cellular fatty acid composition (%) of strain MB-PO13 T and related Streptomyces species. Strains: 1, strain MB-PO13 T ; 2, S. graminisoli NBRC T ; 3, S. shenzhenensis DSM T ; 4, S. rhizophilus NBRC T ; 5, S. gramineus NBRC T ; 6, S. jiujiangensis JXJ 0074 T. The analyses of 1 to 5 were performed in parallel in this study. Data of 6 are from Zhang et al. 31 Bold type shows the major components (>10%). –, Not detected; tr, traces (<1%); ND, no data. Fatty acid Saturated fatty acids Straight-chain C 12:0 ––––trND C 13:0 ––tr ND C 14:0 tr1.4tr 1.5ND C 15: ––ND C 16: ND C 17:0 tr 1.0tr ND Branched iso-C 12:0 tr – ND iso-C 13:0 tr ND iso-C 14: iso-C 15: iso-C 16: iso-C 17: ND anteiso-C 13:0 tr ND anteiso-C 15: anteiso-C 17: Cyclic cyclohexyl-C 17:0 1.1tr ND Mono-unsaturated fatty acids C 15:1 B–tr–––ND iso-C 16:1 Htr tr3.8 C 16:1 ω9c –ND C 17:1 ω8c–––tr ND C 17:1 ω9c–tr ––ND iso-C 17:1 ω9c–––1.0trND anteiso-C 17:1 Ctr1.21.6––ND anteiso-C 17:1 ω9c–––tr Methyl fatty acid 9-Methyl C 16:0 tr 1.7––ND