Results 1.Miller JR, Siripurkpong P, Hawes J, Majdalawieh A, Ro HS, McLeod RS. The trans-10, cis-12 isomer of conjugated linoleic acid decreases adiponectin.

Slides:



Advertisements
Similar presentations
SDS-PAGE + Western Blot
Advertisements

Western Blot encyclopedia
Western Analysis Laboratory procedure that allows you to:
SEPARATION AND DETECTION OF PROTEINS Part I Vlasta Němcová, Michael Jelínek, Jan Šrámek.
ABE Summer Workshop 2005 Southern & Western Blotting.
Antibody Activity Against Sialidase Used as a Potential Therapeutic Treatment for Autoimmune Disorders Amber Williams, Department of Biology, York College.
By Emily Johnson Summer STEP Program, 2003 Objective: Develop Non-radioactive Western Specific Aims: Show we can use the actin antibody to specifically.
Chapter 3-Contd. Western blotting & SDS-PAGE
Quality Control of Product
Protein Electrophoresis BIT 230. Electrophoresis Separate proteins based on Size (Molecular Weight - MW) SDS PAGE Isoelectric Point Isoelectric focusing.
#Initial Phenotype of Mutant Complementation TestBeta-Gal AssayProbable Mutation 1RedWhiteBlue 2RedWhite 3RedNo growthWhite 4Red White 5Red White 6Red.
Western Blot.
Lab#6 Western Blotting BCH 462[practical].
Rizana Mahroof, Kun Yan Zhu, and Bhadriraju Subramanyam
Western-blotting. Equal amount of protein samples were separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and transferred onto nitrocellulose.
Variations in the ELISA technique Used for testing the amount of antibody to an antigen in serum Lab 6. Preparation of rabbit IgG Enzyme linked Immunosorbent.
Lab.8 8RBs0Ghg_48
5. SEPARATION AND DETECTION OF PROTEINS II SDS-PAGE Jana Vobořilová, Anna Kotrbová-Kozak, Vlasta Fürstová, Tereza Kopská.
1 Talk Outline  Excerpt from talk given Nov 06 at the American Electrophoresis Society meeting in San Francisco  P-Serine & P-Threonine Western blotting.
THE ROLE OF RENALASE IN BROWN ADIPOSE TISSUE AND OBESITY Monica Chand Supervisor: Dr Harpal S Randeva Warwick Medical School, University of Warwick, Gibbet.
Identifying a Potential Biotechnology Product
Western Blotting.
WHAT IS A WESTERN BLOT?.
Expression and Localization of a Hypothetical Protein of Trypanosoma brucei Savannah Mwesigwa 1, Monica Namayanja 1, Phillip Magambo 1, Sylvester Ochwo.
The expression of Hsp 70 in Hexagenia limbata: A molecular biomarker of environmental stress M. Peplinski, J. Provazza, B. O’Donnell Department of Biological.
Development of Western Blots for Actin without the use of radioactivity Geoff Theobald STEP Summer Internship Program June 2003.
Antibody Detection. Part II Detection of Antigens Western Blotting “Dot-Blot Assay” Positive Control Primary antibody (IgY) Lysed E. Coli Cells Lysed.
CHOIRUNIL CHOTIMAH INTRODUCTION Leishmaniasis Leishmania Parasites promastigotes amastigotes Difficult to treat Need effective vaccine.
Yeast Secretory Pathway Lab 3: Probing & Developing the Western Blot Your blots have been incubating in blocking buffer (5% milk in PBS with 0.25% Tween)
SEPARATION AND DETECTION OF PROTEINS Part I Jana Vobořilová, Anna Kotrbová-Kozak, Vlasta Fürstová, Tereza Kopská.
Determining the Effect of Triclosan on the Growth of Cancer Cells Lydia Alf and Winnifred Bryant Ph. D. Department of Biology University of Wisconsin,
Western blotting. Antibodies in the Immune System Structure: 2 heavy chains + 2 light chains Disulfide bonds 2 antigen binding sites Isotypes: IgG, IgM,
Western Blot Lab. Western Blot reagents and equipment Mini Trans-Blot Apparatus : Passes electric current horizontally through gel – forcing negatively.
 Non-enveloped T=3 icosahedral symmetry of identical sequence.  Single stranded positive sense RNA virus.  Coat protein (CP) coded by sub-genomic strand.
Lecturer: David. * Reverse transcription PCR * Used to detect RNA levels * RNA is converted to cDNA by reverse transcriptase * Then it is amplified.
Western Blotting. Introduction … Western blotting, also known as immunoblotting or protein blotting, is a technique used to detect the presence of a specific.
Electrophoresis 7 th Grade,. Learning Objectives Understanding how electrophoresis facilitates the separation of molecules Be familiar with the types.
Optimizing Purification and Quantitative Detection of Lysozyme and Avidin Tatiana Soboleva, Ryan Colakovic, Dr. Theresa Salerno (Faculty Mentor)
Comparative Proteomics Kit II: Western Blot Analysis Module
Polyacrylamide Gel Electrophoresis. Electrophoresis Horizontal Agarose Gels Agarose forms a gel or molecular sieve that supports the movement of small.
Measuring PDE4A and PDE4B in Normal and Diseased Mouse Leg Muscle Jessica Hall & Brittany Matthews 1 June 2001.
ISOLATION, SEPARATION AND DETECTION OF PROTEINS part I Michael Jelínek, Jan Šrámek Lenka Rossmeislová.
Western blotting Pete Jones.
 Insulin is a peptide hormone released by beta cells when glucose concentrations exceed normal levels (70–110 mg/dL).  The effects of insulin on its.
Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.
WESTERN BLOT Reagents: 2x SDS buffer Running buffer Transfer buffer
OBJECTIVE CONCLUSIONS ABSTRACT Establishment of ELISA for AgI/II protein detection using monoclonal anti-AgI/II antibody Jae-Gon Kim, jeong-Yeol Park,
Quality Control of Product
Lab# 5 Western Blot BCH 462[practical].
Comparative Proteomics Kit II: Western Blot Analysis Module
Blot, Blot, Western Baby Kristin B. Dupre June 30th, 2011.
Parkinson’s Diseased Proteins in Relation to Autophagy
Volume 66, Issue 4, Pages (October 2004)
Peroxidated Squalene Induces the Production of Inflammatory Mediators in HaCaT Keratinocytes: A Possible Role in Acne Vulgaris  Monica Ottaviani, Theodosis.
Volume 127, Issue 2, Pages (August 2004)
Complex I Complex III Complex IV Complex II Supplemental Figure 3
Volume 58, Issue 5, Pages (November 2000)
Generation and Characterization of a Polyclonal Antipeptide Antibody to Human Glycodelin  Archna S Poddar, Jong G Kim, Kiran P Gill, Barry N Bates, Nalini.
Volume 64, Issue 2, Pages (August 2003)
Protein immuno-blotting, detection and analysis
Different applications of protein electrophorasis
Volume 128, Issue 4, Pages (April 2005)
Volume 63, Issue 4, Pages (April 2003)
Activation of Akt as a Mechanism for Tumor Immune Evasion
Effects of Lp(a) Treatment on HAVICs HAVICs were incubated in OSM in the presence or absence of 50 μg/ml purified Lp(a) (Athens Research & Technology,
Fig. 2. Sera IgE reactivity patterns and the frequency of reactivity to raw and cooked shrimp extracts by Western blot. (A, C) All sera were diluted at.
Lab# 5 Western Blot BCH 462[practical].
IRS-1 and -2 expression in four mesangial cell lines from different D-NOD (A and B) and ND-NOD (C and D) mice. IRS-1 and -2 expression in four mesangial.
Western immunoblot of Acanthamoeba whole-cell lysates reacted with normal human serum, demonstrating immunoreactivity against Acanthamoeba antigens. Western.
ODC protein expression in paired benign and cancer tissue obtained from patients with PCA. The protein expression was measured by immunoblot analysis in.
Presentation transcript:

Results 1.Miller JR, Siripurkpong P, Hawes J, Majdalawieh A, Ro HS, McLeod RS. The trans-10, cis-12 isomer of conjugated linoleic acid decreases adiponectin assembly by PPARgamma-dependent and PPARgamma-independent mechanisms. J Lipid Res Mar;49(3): Wikipedia. Adiponectin. California. Wikimedia Foundation, Inc.; 2004 [updated 2009 Dec 17; cited 2010 Mar 20]. Available from: References 1.Measuring the concentration of protein by BCA TM Protein Assay Kit - Sample : cell lysate, medium 2. Separating protein by Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis (SDS-PAGE) - Marker : Pre-stained molecular weight  Western Blot Protein molecular weight  Comassie blue - Sample : cell lysate, medium 3. Detection of the Adiponectin by Western Blot The conditions for detection of the adiponectin from 3T3-L1 cell by Western blot technique. 1) The loading protein on SDS-PAGE - Protein Amount (cell lysate) : 10 µg, 20 µg, 30 µg, 40 µg 2) Time for transferring protein into nitrocellulose membrane - 90 min w/ ice Vs 90 min w/o ice - 90 min w/ ice Vs 180 min w/ ice 3) Type of blocking reagent - BSA, Skim milk (Oxoid), Skim milk (from Japan) 4) Dilution of primary antibody (mouse anti-adiponectin antibody) - 1:5,000 1:10,000 and 1:15,000 5) Dilution of secondary antibody (goat anti-mouse IgG-HRP) - 1:5,000 1:10,000 Methods and Materials These optimal conditions will be effectively useful for study the adiponectin levels from 3T3-L1 cell, both in cell and in medium. However, proteins in the polyacrylamide gel cannot completely transfer into the nitrocellulose membrane, which this problem will need to be solved in the further study. Conclusions Introduction Adiponectin is a protein hormone, secreted from adipose tissue. It plays an important role in the control of glucose and fat metabolism in the body. Therefore, when the lower level of adiponectin occurs, it could be the cause of many diseases. Particularly Coronary Artery disease and Diabetes Mellitus type 2, which is a major health problem of Thailand. Recently, adiponectin is widely studied from many researchers. There are several methods for detection of the adiponectin. Western Blot is considered as one of popular and reasonable method because it has the high sensitivity and specificity, and does not require tools that are very expensive. Therefore, the purpose of this study is to optimize the conditions for detection of the adiponectin from 3T3-L1 cell by Western blot technique. The loading protein on SDS-PAGE, time for transferring protein into nitrocellulose membrane, type of blocking reagent, the primary and secondary antibody dilutions were optimized for adiponectin detection. Determination of Adiponectin from 3T3-L1 cell by Western Blot Atittaya Buareaung, Thawankorn Suansong, Pilaiwan Siripurkpong Atittaya Buareaung, Thawankorn Suansong, Pilaiwan Siripurkpong Department of Medical Technology, Faculty of Allied Health Science Thammasat University Figure 1. Figure 2a. Various amount of protein transfer by using ice for 90 min Figure 2b. Various amount of protein transfer by using ice for 180 min Figure 3. Our results showed that the optimal conditions for adiponectin detection by Western blot are 10 μg of loading protein (Fig.1), 180 minutes for protein transfer with ice surrounding chamber (Fig.2a.&2b.). The proper blocking reagent is Skim Milk from Japan (Fig.3), and the dilution of the appropriate primary is 1:15,000 (Fig.4) and the dilution of the appropriate secondary antibodies is 1:10,000 (Fig.5) BSASkim milk (oxoid)Skim milk (from Japan) 1 st Antibody –1:5,000 Chem. image X-ray film 1 st Antibody –1:10,000 Chem. image X-ray film Figure 4. 1 st Antibody –1:15,000 Chem. image X-ray film Figure 5. 2 nd Antibody –1:5,0002 nd Antibody –1:10,000 Chem. image X-ray film MethodCondition Protein amount10 µg20 µg30 µg40 µg Transfer protein 90 min w/ ice 90 min w/out ice 180 min w/ ice - Blocking reagent BSA Skim milk (Oxoid) Skim milk (Japan) - 1 st Antibody1:5,0001:10,0001:15, nd Antibody1:5,0001:10,000-- Table 1. The optimal conditions for adiponectin detection Acknowledgement We are grateful to thank the Thammasat University for research scholarship and Department of Medical Technology, Faculty of Allied Health Sciences, Thammasat University for providing the equipments us to conduct this research. Protein Amount gg gg