Vrn1_T4 (AS_ITA_21_HQ910536) genomic sequence vs. corresponding fragment from T. aestivum Vrn-A1: F primer Exon 3Intron 3 Exon 4 Intron 4 Supplement 4:

Slides:

Advertisements

Similar presentations

Supplement 5 Comparison of homoeologous Kanota x Ogle (KO) linkage groups 24_26_34 and 22_44_18 and the location of As-Vrn1 mapped as an RFLP in KO. Stacked.

Advertisements

EAnnot: A genome annotation tool using experimental evidence Aniko Sabo & Li Ding Genome Sequencing Center Washington University, St. Louis.

Central dogma DNA is made (transcribed) into RNA RNA is made (translated) into protein.

SBI 4U November 14 th, What is the central dogma? 2. Where does translation occur in the cell? 3. Where does transcription occur in the cell?

1 Computational Molecular Biology MPI for Molecular Genetics DNA sequence analysis Gene prediction Gene prediction methods Gene indices Mapping cDNA on.

1 Computational Molecular Biology MPI for Molecular Genetics DNA sequence analysis Gene prediction methods Gene indices Mapping cDNA on genomic DNA Genome-genome.

PROMoter SCanning/ANalysis tool. Goal Creating a tool to analyse a set of putative promoter sequences and recognize known and unknown promoters, with.

Additional Powerful Molecular Techniques Synthesis of cDNA (complimentary DNA) Polymerase Chain Reaction (PCR) Microarray analysis Link to Gene Therapy.

Origins of recently gained introns in Caenorhabditis Avril Coghlan and Kenneth H. Wolfe Department of Genetics, Trinity College Dublin, Ireland.

CSE182-L12 Gene Finding.

Bioinformatics Alternative splicing Multiple isoforms Exonic Splicing Enhancers (ESE) and Silencers (ESS) SpliceNest Lecture 13.

UCSC Known Genes Version 3 Take 10. Overall Pipeline Get alignments etc. from database Remove antibody fragments Clean alignments, project to genome Cluster.

Fig. S1 A622 1 MVVSEKSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVT 60 A622L V V A622.

Chapter 6 Gene Prediction: Finding Genes in the Human Genome.

Fine Structure and Analysis of Eukaryotic Genes

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

Genome Annotation BBSI July 14, 2005 Rita Shiang.

Screening a Library Plate out library on nutrient agar in petri dishes. Up to 50,000 plaques or colonies per plate.

Fig Chapter 12: Genomics. Genomics: the study of whole-genome structure, organization, and function Structural genomics: the physical genome; whole.

발표자 석사 2 년 김태형 Vol. 11, Issue 3, , March 2001 Comparative DNA Sequence Analysis of Mouse and Human Protocadherin Gene Clusters 인간과 마우스의 PCDH 유전자.

LOC_Os02g08480 Supplementary Figure S1. Exons shorter than a read length have few or no reads aligned. The gene at LOC_Os02g08040 contains exons shorter.

Remember the limitations? –You must know the sequence of the primer sites to use PCR –How do you go about sequencing regions of a genome about which you.

1 The Interrupted Gene. Ex Biochem c3-interrupted gene Introduction Figure 3.1.

5.3 – Advances in Genetics Trashketball!. Selecting organisms with desired traits to be parents of the next generation is… A. Inbreeding A. Inbreeding.

Supplemental Figure 1. The wxr3 mutant exhibits decreased expression of CYCB1;1, SCR and SHR compared with the control. A and B, Expression of ProCYCB1;1:GUS.

Gene Prediction: Similarity-Based Methods (Lecture for CS498-CXZ Algorithms in Bioinformatics) Sept. 15, 2005 ChengXiang Zhai Department of Computer Science.

Using Exons to Define Isoforms in PRO Timothy Danford Novartis Institutes for Biomedical Research PRO / AlzForum Kickoff Meeting Oct. 4, 2011.

Eukaryotic Gene Prediction Rui Alves. How are eukaryotic genes different? DNA RNA Pol mRNA Ryb Protein.

DNA LIBRARIES Dr. E. What Are DNA Libraries? A DNA library is a collection of DNA fragments that have been cloned into a plasmid and the plasmid is transformed.

Comparative Genomics Methods for Alternative Splicing of Eukaryotic Genes Liliana Florea Department of Computer Science Department of Biochemistry GWU.

While replication, one strand will form a continuous copy while the other form a series of short “Okazaki” fragments Genetic traits can be transferred.

Bioinformatics Workshops 1 & 2 1. use of public database/search sites - range of data and access methods - interpretation of search results - understanding.

Recombinant DNA Technology. DNA replication refers to the scientific process in which a specific sequence of DNA is replicated in vitro, to produce multiple.

August 20, 2007 BDGP modENCODE Data Production. BDGP Data Production Project Goals 21,000 RACE experiments 6,000 cDNA’s from directed screening and full.

Clones and the Human Genome Project Unit 11 Lesson 3.

A Molecular Toolkit AP Biology Fall The Scissors: Restriction Enzymes  Bacteria possess restriction enzymes whose usual function is to cut apart.

Figure S1. RACE mapped transcription starts and polyA signals of Ogre CL5 and Ogre CL5del and putative splice site of Ogre CL5 and Ogre CL5del in Silene.

Primer on Reading Frames and Phase Wilson Leung08/2012.

A knowledge-based approach to integrated genome annotation Michael Brent Washington University.

The Central Dogma of Molecular Biology DNA  RNA  Protein  Trait.

Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.

REVIEW OF MOLECULAR GENETICS DR. EDELBERG. Genes, DNA, & Chromosomes.

Figure 1. RT–PCR identification of an abnormal transcript of the PTPN6 gene in normal and leukemic bone marrow cells and cell line. (a) Diagrammatic representation.

Primer on Reading Frames and Phase

Schematic drawing of the human X chromosome and physical map the Xp interval carrying the ND gene. A 640-kb yeast artificial chromosome (YAC) clone was.

A Fast Hybrid Short Read Fragment Assembly Algorithm

5' breakpoint in intron 2 (chr19:1,219,187-1,219,238 shown)

Pick a Gene Assignment 4 Requirements

PlantGDB: Annotation Principles & Procedures

A spliceosomal intron of mitochondrial DNA origin

GENE REGULATION prokaryotic cells – have about 2,000 genes

Transcription Definition

Christopher M. Watson, Nick Camm, Laura A

Practice Clone 3 Download and get ready!.

Analysis of an exon 1 polymorphism of the B2 bradykinin receptor gene and its transcript in normal subjects and patients with C1 inhibitor deficiency

Supplemental Figure 3 A B C T-DNA 1 2 RGLG1 2329bp 3 T-DNA 1 2 RGLG2

Structure of the GM2A Gene: Identification of an Exon 2 Nonsense Mutation and a Naturally Occurring Transcript with an In-Frame Deletion of Exon 2 Biao.

Gene Sizes Vary Strachan p146 DYSTROPHIN.

From DNA to Protein Class 4 02/11/04 RBIO-0002-U1.

Characterization and Mutation Analysis of Human LEFTY A and LEFTY B, Homologues of Murine Genes Implicated in Left-Right Axis Development K. Kosaki,

KIT Gene Deletions at the Intron 10−Exon 11 Boundary in GI Stromal Tumors Christopher L. Corless, Laura McGreevey, Ajia Town, Arin Schroeder, Troy Bainbridge,

Mutation in pycr1a exon 3 disrupts predicted exonic splicing enhancers

(A) yellow cDNA comparison among wild-type and ch mutants

Cloning and mapping of zebrafish nls/raldh2.

Genomic structure of LTBP-4 around the 3rd 8-Cys repeat.

Structure of the IFL1 Gene and the Nature of the Mutations in the ifl1 Alleles.(A) A schematic representation of the exon and intron organization of the.

Mutation of the Ca2+ Channel β Subunit Gene Cchb4 Is Associated with Ataxia and Seizures in the Lethargic (lh) Mouse Daniel L Burgess, Julie M Jones,

Exon Skipping in IVD RNA Processing in Isovaleric Acidemia Caused by Point Mutations in the Coding Region of the IVD Gene Jerry Vockley, Peter K. Rogan,

Figure Genetic characterization of the novel GYG1 gene mutation (A) GYG1_cDNA sequence and position of primers used. Genetic characterization of the novel.

Presentation transcript:

Vrn1_T4 (AS_ITA_21_HQ910536) genomic sequence vs. corresponding fragment from T. aestivum Vrn-A1: F primer Exon 3Intron 3 Exon 4 Intron 4 Supplement 4: alignments for putative Vrn1 clone used for RFLP mapping (November, 2011):

Intron 4Exon 5 Intron 5 R primer Intron 5 Exon 6 79% identity

AS_ITA_21_HQ spliced sequence* vs. A. strigosa Fruitful-like cDNA and spliced T. aestivum Vrn-A1 sequence: * Two sequencing errors corrected to match oat Vrn1 consensus sequence

AS_ITA_21_HQ translated sequence vs. Z. mays TF15 protein sequence and translated A. strigosa Fruitful-like and T. aestivum Vrn-A1 sequences: K-box motif