BWBmin Administrative Web Interface for Paracel BioView WorkBench Frances Tong Marc Rieffel, PhD Paracel Southern California Bioinformatics Summer Institute.

Slides:



Advertisements
Similar presentations
23 July 2012 Thomas Bergauer (HEPHY Vienna) Belle II SVD Construction Database 12 th B2GM Bad Aibling.
Advertisements

Computer Software 3 Section A Software Basics CHAPTER PARSONS/OJA
Bookshelf.EXE - BX A dynamic version of Bookshelf –Automatic submission of algorithm implementations, data and benchmarks into database Distributed computing.
Aug. 20, JPL, SoCalBSI '091 The power of bioinformatics tools in cancer research Early Detection Research Network, JPL Mentors: Dr. Chris Mattmann,
A Genomic Survey of Polymorphism and Linkage Disequilibrium Imran Mohiuddin Magnus Nordborg, Ph.D. University of Southern California.
PHP (2) – Functions, Arrays, Databases, and sessions.
B.Sc. Multimedia ComputingMedia Technologies Database Technologies.
11 WORKING WITH GROUPS Chapter 7. Chapter 7: WORKING WITH GROUPS2 CHAPTER OVERVIEW  Understand the functions of groups and how to use them.  Understand.
Cornell University Library Instruction Statistics Reporting System Members: Patrick Chen (pyc7) Soo-Yung Cho (sc444) Gregg Herlacher (gah24) Wilson Muyenzi.
Input Validation For Free Text Fields ADD Project Members: Hagar Offer & Ran Mor Academic Advisor: Dr Gera Weiss Technical Advisors: Raffi Lipkin & Nadav.
Multiple Tiers in Action
Larry Lam Southern California Bioinformatics Summer Institute 2009 Graeber Lab – Crump Institute for Molecular Imaging UCLA A Data Management and Analysis.
Reference and Instruction Automated Statistics Gathering and Reporting System Members: Patrick Chen (pyc7) Soo-Yung Cho (sc444) Gregg Herlacher (gah24)
Macros Tutorial Week 20. Objectives By the end of this tutorial you should understand how to: Create macros Assign macros to events Associate macros with.
ViaLogy Lien Chung Jim Breaux, Ph.D. SoCalBSI 2004 “ Improvements to Microarray Analytical Methods and Development of Differential Expression Toolkit ”
Matt Masson| Senior Program Manager
Chapter 7 Managing Data Sources. ASP.NET 2.0, Third Edition2.
Collaboration Suite Business Process Management
Computer Science 101 Web Access to Databases Overview of Web Access to Databases.
MIS2502: Data Analytics MySQL and SQL Workbench David Schuff
Project Implementation for COSC 5050 Distributed Database Applications Lab1.
Linux Operations and Administration
Batch Import/Export/Restore/Archive
Coding Reporting Utilities.  Desktop ◦ C#  5 years  Web-based ◦ ASP.NET (C#)  5 years ◦ ASP.Classic (VB)  2+ years ◦ PHP  3+ years ◦ HTML5  1 year.
Linux Operations and Administration
MySQL GUI Administration Tools Rob Donahue Manager, Distributed Systems Development May 7th, 2001 Rob Donahue Manager, Distributed Systems Development.
Module 8 Configuring and Securing SharePoint Services and Service Applications.
Student Learning Environment on the World Wide Web l CGI-programming in Perl for the connection of databases over the Internet. l Web authoring using Frontpage.
1 California State University, Fullerton Chapter 8 Personal Productivity and Problem Solving.
Internet Forms and Database Bob Kisel Amgraf, Inc.
© 2004 Hewlett-Packard Development Company, L.P. The information contained herein is subject to change without notice SISP Training Documentation Template.
Nightly Releases and Testing Alexander Undrus Atlas SW week, May
9 Chapter Nine Compiled Web Server Programs. 9 Chapter Objectives Learn about Common Gateway Interface (CGI) Create CGI programs that generate dynamic.
1 In the good old days... Years ago… the WWW was made up of (mostly) static documents. –Each URL corresponded to a single file stored on some hard disk.
10/13/2015 ©2006 Scott Miller, University of Victoria 1 Content Serving Static vs. Dynamic Content Web Servers Server Flow Control Rev. 2.0.
9 1 DBM Databases CGI/Perl Programming By Diane Zak.
SUSE Linux Enterprise Desktop Administration Chapter 6 Manage Software.
11 Overview Paracel GeneMatcher2. 22 GeneMatcher2 The GeneMatcher system comprises of hardware and software components that significantly accelerate a.
Get your hands dirty cleaning data European EMu Users Meeting, 3rd June. - Elizabeth Bruton, Museum of the History of Science, Oxford
CERN - IT Department CH-1211 Genève 23 Switzerland t DB Development Tools Benthic SQL Developer Application Express WLCG Service Reliability.
Microsoft Access Database Software.
INDIAN AGRICULTURAL STATISTICS RESEARCH INSTITUTE, NEW DELHI PROJECT ” Development of Software for Online Information System on Personnel Management.
Tips for System Administrators. Tips for System Admins  Use Macros to automate repetitive tasks  Must use telnet or Presentation Manager  Press Control-R.
The BioBox Initiative: Bio-ClusterGrid Maddie Wong Technical Marketing Engineer Sun APSTC – Asia Pacific Science & Technology Center.
Pipeline Basics Jared Crossley NRAO NRAO. What is a data pipeline?  One or more programs that perform a task with reduced user interaction.  May be.
Senior Project, 2015, Spring Senior Project Website –Version 5 Student: Yamel Peraza, Florida International University Mentor: Masoud Sadjadi, Florida.
Enigma Mutiara Sdn Bhd Computer Based Learning (CBL) HSE Procedures.
07/21/97 MOSS Project Introduction and Definition -Senior Project-
BIF713 Operating System Concepts MS Windows. Agenda 1. What is an Operating System (definition)? 2. Types of Operating Systems 3. Basic Operations: –
File Manager A Robust User Interface to the Stanford Microarray Database (SDM) M.S. Pilot Adviser: M. W. Berry John Clayton England, III 04/10/2003.
Linux Operations and Administration
JavaScript 101 Introduction to Programming. Topics What is programming? The common elements found in most programming languages Introduction to JavaScript.
Microsoft ® Official Course Module 6 Managing Software Distribution and Deployment by Using Packages and Programs.
Integration of BioInformatics tools at NUS. GenBank Growth Chart Year Bases.
Gene_identifier color_no gtm1_mouse 2 gtm2_mouse 2 >fasta_format_description_line >GTM1_HUMAN GLUTATHIONE S-TRANSFERASE MU 1 (GSTM1-1) PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI.
Visual Database Creation with MySQL Workbench 도시정보시스템 설계
MYSQL AND MYSQL WORKBENCH MIS2502 Data Analytics.
CIS-NG CASREP Information System Next Generation Shawn Baugh Amy Ramirez Amy Lee Alex Sanin Sam Avanessians.
Open Science Grid Configuring RSV OSG Resource & Service Validation Thomas Wang Grid Operations Center (OSG-GOC) Indiana University.
1 Bioinformatics Tools for Genotyping Frances Tong Dr. Garry Larson, Ph.D City of Hope Department of Molecular Medicine Southern California Bioinformatics.
GNU EPrints 2 Overview Christopher Gutteridge 19 th October 2002 CERN. Geneva, Switzerland.
Operating System Concepts
PERL.
mysql and mysql workbench
GLAST Release Manager Automated code compilation via the Release Manager Navid Golpayegani, GSFC/SSAI Overview The Release Manager is a program responsible.
Building A Web-based University Archive
BLAST.
MIS2502: Data Analytics MySQL and SQL Workbench
Team 21: Project Design Team Members: Nathan Staley Steven Murray
Web Application Development Using PHP
Presentation transcript:

BWBmin Administrative Web Interface for Paracel BioView WorkBench Frances Tong Marc Rieffel, PhD Paracel Southern California Bioinformatics Summer Institute Summer 2004 Funded by the National Science Foundation and the National Institutes of Health

Overview Paracel products –Paracel BLAST Software for BLAST searching –GeneMatcher Supercomputer for genetic algorithms (Smith-Waterman, etc) –BioView Workbench Graphical interface for user to run Paracel BLAST and algorithms on GeneMatcher. Goal : Develop a user-friendly web interface for administration of BioView Workbench

BioView Workbench : Graphical User Interface for Paracel BLAST and GeneMatcher Searches Search submission interface which lets you access Paracel algorithms without entering the command-line environment

Administrative Tasks for BioView Workbench Database management : – loading new databases – modifying existing databases – deleting existing databases – creating new database sets – adding new members to sets – removing members from sets – deleting entire sets General Configuration : – setting of general system parameters Each requires command line interface and/or manual editing of specific files

BWBmin : User-friendly alternative Web interface for admin tasks Highly awaited by biologists Built from scratch in 9 weeks as a Webmin module Currently consists of 7 CGI scripts written in Perl, HTML and Javascript, a Perl module and other setup files

Before BWBmin… command line usage Ex: loading a new database (UCSC Human Chromosome 11) into Paracel BLAST and GeneMatcher adding to Paracel BLAST adding to GeneMatcher still not done yet ! …

~ open and edit database configuration file for BioView Workbench Beginning of file… Go to the end of the file and type in database information according to the format: Hash table : ‘Key’ => { name => ‘ ’, type => ‘----’, seqcount => ‘----’, date => ‘-----’, btk => ‘ ’, btkoracle => ‘ ’, pb => ‘ ’, };

a web-based interface for system administration for Unix developed by Jamie Cameron anyone can develop and distribute their own Webmin modules for any purpose open source at

Advantages of BWBmin Automates and makes admin tasks for Paracel BLAST and GeneMatcher more user friendly and faster –Elimination of multiple steps –No dealing with the syntax errors that may result with the command line interface and manual editing of configuration files

General Configuration

Database Management

Loading Databases Load fasta file as Paracel BLAST formatted database Load fasta file as GeneMatcher formatted database Load fasta file as GeneMatcher formatted query Input New Database Information

Modifying Databases

Deleting Databases Selectively remove databases

Loading Existing Databases onto BWB

Creating Database Sets

Removing Members from Database Sets

Future Work Construction of similar pages for managing: – Paracel Filtering Package – Preloaded queries – Score matrices Building of release for clients

Acknowledgements Paracel Dr. Marc Rieffel Dave Meyer Peter Wilson Jun Qian Mike Curtin SoCalBSI Dr. Jamil Momand Dr. Nancy Warter-Perez Dr. Sandra Sharp Dr. Wendie Johnston Jackie Heras Fellow Interns National Science Foundation : National Institutes of Health