Tertiary protein structure viewing and prediction July 5, 2006 Learning objectives- Learn how to manipulate protein structures with Deep View software.

Slides:



Advertisements
Similar presentations
Applications of Homology Modeling
Advertisements

PROTEOMICS 3D Structure Prediction. Contents Protein 3D structure. –Basics –PDB –Prediction approaches Protein classification.
Tutorial Homology Modelling. A Brief Introduction to Homology Modeling.
Protein Threading Zhanggroup Overview Background protein structure protein folding and designability Protein threading Current limitations.
Prediction to Protein Structure Fall 2005 CSC 487/687 Computing for Bioinformatics.
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modeling Anne Mølgaard, CBS, BioCentrum, DTU.
Tertiary protein structure viewing and prediction July 1, 2009 Learning objectives- Learn how to manipulate protein structures with Deep View software.
Protein Structure, Databases and Structural Alignment
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
FSSP uses DALI alignments to classify structures all PDB entries representative set of structures representative set of domains group domains into fold.
Homology modelling ? X-ray ? NMR ?. Homology Modelling !
Computational Biology, Part 10 Protein Structure Prediction and Display Robert F. Murphy Copyright  1996, 1999, All rights reserved.
Summary Protein design seeks to find amino acid sequences which stably fold into specific 3-D structures. Modeling the inherent flexibility of the protein.
The Protein Data Bank (PDB)
. Protein Structure Prediction [Based on Structural Bioinformatics, section VII]
Tertiary protein structure modelling May 31, 2005 Graded papers will handed back Thursday Quiz#4 today Learning objectives- Continue to learn how to manipulate.
1 Protein Structure Prediction Reporter: Chia-Chang Wang Date: April 1, 2005.
Protein structure prediction May 30, 2002 Quiz#4 on June 4 Learning objectives-Understand difference between primary secondary and tertiary structure.
Protein Structure Prediction Samantha Chui Oct. 26, 2004.
Homology Modeling Seminar produced by Hanka Venselaar.
Protein Tertiary Structure Prediction Structural Bioinformatics.
Protein Structures.
Protein Sequence Analysis - Overview Raja Mazumder Senior Protein Scientist, PIR Assistant Professor, Department of Biochemistry and Molecular Biology.
Homology Modeling David Shiuan Department of Life Science and Institute of Biotechnology National Dong Hwa University.
Construyendo modelos 3D de proteinas ‘fold recognition / threading’
Tertiary Structure Prediction Methods Any given protein sequence Structure selection Compare sequence with proteins have solved structure Homology Modeling.
Practical session 2b Introduction to 3D Modelling and threading 9:30am-10:00am 3D modeling and threading 10:00am-10:30am Analysis of mutations in MYH6.
COMPARATIVE or HOMOLOGY MODELING
Protein Sequence Alignment and Database Searching.
A new Approach to Structural Prediction of Proteins Heiko Schröder Bertil Schmidt Jiujiang Zhu School of Computer Engineering Nanyang Technological University.
BALBES (Current working name) A. Vagin, F. Long, J. Foadi, A. Lebedev G. Murshudov Chemistry Department, University of York.
Representations of Molecular Structure: Bonds Only.
1 P9 Extra Discussion Slides. Sequence-Structure-Function Relationships Proteins of similar sequences fold into similar structures and perform similar.
Protein Folding Programs By Asım OKUR CSE 549 November 14, 2002.
MolIDE2: Homology Modeling Of Protein Oligomers And Complexes Qiang Wang, Qifang Xu, Guoli Wang, and Roland L. Dunbrack, Jr. Fox Chase Cancer Center Philadelphia,
Protein Structure & Modeling Biology 224 Instructor: Tom Peavy Nov 18 & 23, 2009
Protein secondary structure Prediction Why 2 nd Structure prediction? The problem Seq: RPLQGLVLDTQLYGFPGAFDDWERFMRE Pred:CCCCCHHHHHCCCCEEEECCHHHHHHCC.
Module 3 Protein Structure Database/Structure Analysis Learning objectives Understand how information is stored in PDB Learn how to read a PDB flat file.
Protein Tertiary Structure. Protein Data Bank (PDB) Contains all known 3D structural data of large biological molecules, mostly proteins and nucleic acids:
Structure prediction: Homology modeling
Protein Sequence Analysis - Overview - NIH Proteomics Workshop 2007 Raja Mazumder Scientific Coordinator, PIR Research Assistant Professor, Department.
Predicting Protein Structure: Comparative Modeling (homology modeling)
Protein Structure Prediction: Homology Modeling & Threading/Fold Recognition D. Mohanty NII, New Delhi.
Modelling protein tertiary structure Ram Samudrala University of Washington.
Introduction to Protein Structure Prediction BMI/CS 576 Colin Dewey Fall 2008.
Homology modeling with SWISS-MODEL
Protein Folding & Biospectroscopy Lecture 6 F14PFB David Robinson.
MINRMS: an efficient algorithm for determining protein structure similarity using root-mean-squared-distance Andrew I. Jewett, Conrad C. Huang and Thomas.
Query sequence MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDN GVDGEWTYTE Structure-Sequence alignment “Structure is better preserved than sequence” Me! Non-redundant.
Structural alignment methods Like in sequence alignment, try to find best correspondence: –Look at atoms –A 3-dimensional problem –No a priori knowledge.
Structural classification of Proteins SCOP Classification: consists of a database Family Evolutionarily related with a significant sequence identity Superfamily.
EMBL-EBI Eugene Krissinel SSM - MSDfold. EMBL-EBI MSDfold (SSM)
Protein Tertiary Structure Prediction Structural Bioinformatics.
Local Flexibility Aids Protein Multiple Structure Alignment Matt Menke Bonnie Berger Lenore Cowen.
Protein Structure Prediction: Threading and Rosetta BMI/CS 576 Colin Dewey Fall 2008.
PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.
Find the optimal alignment ? +. Optimal Alignment Find the highest number of atoms aligned with the lowest RMSD (Root Mean Squared Deviation) Find a balance.
Lab Lab 10.2: Homology Modeling Lab Boris Steipe Departments of Biochemistry and.
PROTEIN MODELLING Presented by Sadhana S.
Protein Structure Prediction and Protein Homology modeling
Protein dynamics Folding/unfolding dynamics
Protein dynamics Folding/unfolding dynamics
Identify D. melanogaster ortholog
Protein Structures.
Molecular Modeling By Rashmi Shrivastava Lecturer
Homology Modeling.
Protein structure prediction.
Homology modeling in short…
Presentation transcript:

Tertiary protein structure viewing and prediction July 5, 2006 Learning objectives- Learn how to manipulate protein structures with Deep View software. Learn the steps to protein structure modeling with Deep View. Workshop-Manipulation of the lysozyme and hemoglobin.

Protein structure viewers RasMol Deep View Cn3D WebLabViewer Chimera

Steps to tertiary structure prediction Comparative protein modeling Extrapolates a new structure based on solved structures that are related by sequence. Steps for SWISS-ModelSWISS-Model 1. Identification of modeling templates. 2. Alignment between target and templates. 3. Model building. 4. Evaluation.

Step 1: Identification of modeling templates One chooses a cutoff value from FastA or BLAST search ( E<10 -5 ) and perform BLAST search of Protein Data Bank. Up to ten structure templates can be used but the one with the highest sequence similarity to the target sequence (lowest E-value) is designated as the reference template. Its structure is given the most weight. C  atoms of the templates are selected for superimposition. This generates a structurally corrected multiple sequence alignment

Step 2: Alignment Up to 5 template structures are superimposed. Incompatible templates are removed. Pairwise alignment is created between target and main template structures.

Step 3: Building the model Framework construction Average the position of each atom in target sequence, based on the corresponding atoms in template (start with C  atoms) Each loop is defined by the length of the loop and C  atom coordinates of the four residues preceding and following the loop. Constraint space programming is used. Portions of the target sequence that do not match the template are constructed from a “spare part” algorithm.

Framework construction

Step 3: Building the model Completing the backbone-a library of PDB entries is consulted to add carbonyl groups and amino groups. The 3-D coordinates come from a separate library of pentapeptide backbone fragments. These backbone fragments are fitted onto the target C alpha carbons. The central tri-peptide atoms are averaged from each backbone atom (N,C,C(O)). Side chains are added from a table of most probable rotamers given a certain backbone conformation. Model refinement-minimization of energy (GROMOS96 force field)

First approach mode Step Program/ Method Database Action 1BLASTP2 ExNRL -3D Will find all similarities of target sequence with sequences of known structure. 2SIM- Will select all templates with sequence identities above 25% and projected model size larger than 20 residues. Furthermore, this step will detect domains which can be modeled based on unrelated templates 3-- Generate ProModII input files 4ProModIIExPDB Generate all models 5Gromos96- Energy minimization of all models