Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell

Slides:

Advertisements

Similar presentations

Happy Friday! BELL WORK: Write the questions below AND your answers and highlight/underline key words: 1.What is the product of the process of TRANSLATION?

Advertisements

TRANSLATION The process of converting the information stored in mRNA into a protein is called translation mRNA carries information from a gene to a structure.

Finding prokaryotic genes and non intronic eukaryotic genes

Protein Synthesis Chapter Protein synthesis- the production of proteins The amount and kind of proteins produced in a cell determine the structure.

Translation Section 11-2 cont.. Transcription Translation 20 different amino acids 20 different amino acids A group of three nucleotides in mRNA code.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

Volume 88, Issue 5, Pages (March 1997)

Structure of the Gene for Congenital Nephrotic Syndrome of the Finnish Type (NPHS1) and Characterization of Mutations Ulla Lenkkeri, Minna Männikkö,

Volume 6, Issue 4, Pages (October 2000)

Codon Bias as a Means to Fine-Tune Gene Expression

Fabien Darfeuille, Cecilia Unoson, Jörg Vogel, E. Gerhart H. Wagner

Making Proteins in the Powerhouse

Mark M Metzstein, H.Robert Horvitz Molecular Cell

A [Cu]rious Ribosomal Profiling Pattern Leads to the Discovery of Ribosomal Frameshifting in the Synthesis of a Copper Chaperone John F. Atkins, Gary.

A [Cu]rious Ribosomal Profiling Pattern Leads to the Discovery of Ribosomal Frameshifting in the Synthesis of a Copper Chaperone John F. Atkins, Gary.

Ribosome Evolution for Two Artificial Amino Acids in E. coli

Cleavage of the A Site mRNA Codon during Ribosome Pausing Provides a Mechanism for Translational Quality Control Christopher S Hayes, Robert T Sauer

A Hypervariable Invertebrate Allodeterminant

M. Staples, R. M. A. Graham, V. Hicks, J. Strachan, A

Bacterial genomics: The controlled chaos of shifty pathogens

Ch. 12 Protein Synthesis.

A: OAZ1 mRNA transcript of 775-1, and parental cell lines showing the stop codon introduced by the nonsense mutations in the and transcripts,

The molecular basis of nuclear genetic code change in ciliates

How the Sequence of a Gene Can Tune Its Translation

Volume 84, Issue 3, Pages (February 1996)

Reprogrammed Genetic Decoding in Cellular Gene Expression

Psoriasis Upregulated Phorbolin-1 Shares Structural but not Functional Similarity to the mRNA-Editing Protein Apobec-1 Peder Madsen, Julio E. Celis,

Classification of Introns: U2-Type or U12-Type

A Novel Gene Causing a Mendelian Audiogenic Mouse Epilepsy

Volume 20, Issue 12, Pages (June 2010)

Volume 113, Issue 5, Pages (May 2003)

Volume 10, Issue 5, Pages (May 2003)

Alignment of H-NS, H-NS2, and StpA amino acid sequences.

Volume 88, Issue 5, Pages (March 1997)

Trapping the Ribosome to Control Gene Expression

NRAS, NRAS, Which Mutation Is Fairest of Them All?

Fabien Darfeuille, Cecilia Unoson, Jörg Vogel, E. Gerhart H. Wagner

HLA and Pregnancy: The Paradox of the Fetal Allograft

Volume 20, Issue 6, Pages (December 2005)

C. Héritier, L. Poirel, P. Nordmann

Volume 14, Issue 7, Pages (February 2016)

Ins and Outs of Kinase DFG Motifs

Jun Xu, Roger W. Hendrix, Robert L. Duda Molecular Cell

Correction of translational start site by identification of N-terminal peptide. Correction of translational start site by identification of N-terminal.

Ribosome Evolution for Two Artificial Amino Acids in E. coli

FLS2 Molecular Cell Volume 5, Issue 6, Pages (June 2000)

Volume 10, Issue 5, Pages (May 2003)

William F Burkholder, Iren Kurtser, Alan D Grossman Cell

Sadaf Naz, Chantal M. Giguere, David C. Kohrman, Kristina L

Volume 6, Issue 4, Pages (April 1996)

Alan B Sachs, Peter Sarnow, Matthias W Hentze Cell

Volume 11, Issue 12, Pages (December 2003)

iraL shares sequence identity with iraM from E

Hartmut Scheel, Kay Hofmann Current Biology

Volume 9, Issue 1, Pages (January 2002)

Volume 57, Issue 3, Pages (March 2000)

Spliceosomal snRNAs Cell

Multiple sequence alignment of STAT6 and other STAT proteins produced by ClusterW and ESpript (espript.ibcp.fr/ESPript/ESPript/). Multiple sequence alignment.

Volume 21, Issue 7, Pages (July 2014)

Fig. 4. transparent encodes Mpv17.(A) tra maps to chromosome 20.

Volume 93, Issue 1, Pages (April 1998)

Section 13.2 Protein Synthesis.

Nucleotide and predicted amino acid sequence of the adult mouse brain cdr2 cDNA. Nucleotide and predicted amino acid sequence of the adult mouse brain.

Danna K Morris, Victoria Lundblad Current Biology

Adam T. McGeoch, Stephen D. Bell Cell

Predicted Amino Acid Sequence of the Tomato Cf-4 Protein (Thomas et al

Volume 9, Issue 1, Pages (January 2002)

Maps of Structures of the Ruby Locus in the Different Citrus Species, Orange Accessions, and Hybrids.Thick green arrows, retrotransposon LTRs; thick gray.

Splice isoforms of the JNK1, JNK2, and JNK3 proteins.

Presentation transcript:

Shifty Ciliates Lawrence A. Klobutcher, Philip J. Farabaugh Cell Volume 111, Issue 6, Pages 763-766 (December 2002) DOI: 10.1016/S0092-8674(02)01138-8

Figure 1 Frameshifting in Euplotes (A) The E. octocarinatus Eondr2 gene (black rectangle) is shown. The frame 0 ORF begins with an ATG initiation codon and encodes all of conserved protein kinase domain I, as well as a part of domain II. The second ORF (frame +1) encodes a part of domain II, and the remaining 10 conserved protein kinase domains. Start and stop codons for the 0 and +1 frame ORFs are indicated above and below the gene map, respectively. Figure based on data in Tan et al. (2001b). (B) The sequence of the E. aediculatus La motif protein mRNA in the vicinity of the frameshift site is shown, along with the predicted translation products from the 0 and +1 frame ORFs. The AAA-UAA-A motif is highlighted in gray. A frameshift at positions “1” or “2” would produce amino acid sequences that conform to the consensus of the “La motif,” including a highly conserved phenylalanine (underlined F) residue (for details, see Aigner et al., 2000). Cell 2002 111, 763-766DOI: (10.1016/S0092-8674(02)01138-8)

Figure 2 Model of the Euplotes +1 Translational Frameshift The figure shows a ribosome encountering the AAA-UAA-A frameshift site. See text for details. Cell 2002 111, 763-766DOI: (10.1016/S0092-8674(02)01138-8)