Hox Genes Control the Vertebrate A-P Axis

Slides:



Advertisements
Similar presentations
Control over Genes Chapter 15.
Advertisements

The Build-up of the Red Sequence at z
Homeobox Genes Body organisation.
Cell identity and positional information. How does a neuron find its target?
Shoot Development A. Function and organization of the apical meristem
Transcriptional regulation in Eukaryotes The regulatory elements of bacterial, yeast, and human genes.
Control of Gene Expression
12 The Genetic Control of Development. Gene Regulation in Development Key process in development is pattern formation = emergence of spatially organized.
Warm up Mon 11/3/14 Adv Bio 1. What does the phrase “gene regulation” mean? 2. If the lac operon cannot bind to the repressor.. What would be the outcome?
Negative regulatory proteins bind to operator sequences in the DNA and prevent or weaken RNA polymerase binding.
12-5 Gene Regulation.
Development.
Cell expansion plays a major role in growth Root cells expand their volume 50 times by expanding lengthwise but not widthwise.
Development What causes cell differentiation? Molecular Markers.
Young Leaf Shoot Tip Axillary Bud Node Internode.
Expansion of tandem gene clusters Gene duplication by unequal crossing-over Divergence of coding and regulatory sequences.
TRANSLATION The process of converting the information stored in mRNA into a protein is called translation mRNA carries information from a gene to a structure.
Developmental Genetics. Three Stages of Development division morphogenesis differentiation.
21.1 – 1 As you learned in chapter 12, mitosis gives rise to two daughter cells that are genetically identical to the parent cell. Yet you, the product.
Young Leaf Shoot Tip Axillary Bud Node Internode.
AP Biology Development. AP Biology Big Questions: 1. How does a multicellular organism develop from a zygote? 2. How is the position of the parts of an.
Chapter 21: The Genetic Basis of Development
Chapters 19 - Genetic Analysis of Development: Development Development refers to interaction of then genome with the cytoplasm and external environment.
Chemosensory receptors Chemoreceptors include olfactory receptors. They all have 7 transmembrane domains and form the largest super gene family in animals.
Genetics and Development
The Genetic Basis of Development
Embryonic Development
Chapters 47 & 21 Animal Development & The Genetic Basis of Development.
Gene regulation. How does DNA make different cells? All cells have a full set of DNA Not all the DNA is expressed in each one Promoters and repressors.
Gene Regulation in Prokaryotes - plasmid, not protected by nuclear envelope - DNA is not bound up with histones -One of the best known pathways is the.
Day DateReadingTopic T 9/3 pp (Ch. 6) C. elegans, model systems, and molecular genetics Watch three Audio/Video handouts: 1A), 1B), and 1C Th9/5Ch.
Gene Expression and Development II. Final Exam Sunday, May 27, 8:30-11:30 a.m. Here – SMC A110 Please do course evaluations!
Chapters 19 - Genetic Analysis of Development:
The Genetic Code. The DNA that makes up the human genome can be subdivided into information bytes called genes. Each gene encodes a unique protein that.
Chapter 21: The Genetic Basis of Development Model organisms for study of development.
Patterns in Development Pattern formation must be established via induction prior to morphogenesis. The pattern formation is related to the body plan (its.
Mutations and gene regulation lecture 12-4, 12-5.
Chapter 15 Gene Expression [control of kinds and amount of protein produced.
Homeobox genes and Apoptosis
12.4 Mutations Changes in the genetic material Mistake in copying, carcinogens Single gene = gene mutation Entire chromosome = chromosomal mutation.
Control of Gene Expression
Control of Gene Expression
Development system
Day Date Reading Topic T 9/3 pp (Ch. 6) C. elegans, model systems, and molecular genetics Watch three Audio/Video.
Genes and Body plans
Chapters 19 - Genetic Analysis of Development:
12.4 Mutations Changes in the genetic material
Drosophila Development: Embryogenesis
محاضرة عامة التقنيات الحيوية (هندسة الجينات .. مبادئ وتطبيقات)
Gene Regulation Section 12–5
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Kinds of Mutations Point Mutation Occur at a single point in the DNA
Homework #2 is due 10/17 Bonus #1 is due 10/24 FrakenFlowers.
Fossils provide a record of evolution.
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Regulation of Gene Expression
Control over Genes.
Patterns of control of gene expression
Day Date Reading Topic T 9/3 pp (Ch. 6) C. elegans, model systems, and molecular genetics Watch three Audio/Video.
Control of Gene Expression in Eukaryotic cells
Unit III Information Essential to Life Processes
Chapters 19 - Genetic Analysis of Development:
TIGIT and CD226: Tipping the Balance between Costimulatory and Coinhibitory Molecules to Augment the Cancer Immunotherapy Toolkit  Kristen E. Pauken,
Competence to Respond to Floral Inductive Signals Requires the Homeobox Genes PENNYWISE and POUND-FOOLISH  Harley M.S Smith, Bruce C Campbell, Sarah Hake 
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Protein Synthesis.
13.4 Gene regulation 5/16/19 TB page
KEY CONCEPT Entire genomes are sequenced, studied, and compared.
Presentation transcript:

Hox Genes Control the Vertebrate A-P Axis

Homeodomain protein A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN

The modular construction of plants

 The size of the meristem is controlled by a self-regulating balance between a short-range stimulatory signal produced by cells expressing Wuschel(yellow arrow), and a longer-range inhibitory signal delivered by Clavata3 (red bars).

Domestication of maize and fish

A Hierarchy of Inductive Interactions Subdivides the Vertebrate Embryo

http://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avi

Feedback: Privacy Policy Feedback
Do Not Sell My Personal Information
About project: SlidePlayer Terms of Service

© 2024 SlidePlayer.com Inc. All rights reserved.