Gene Annotation with DNA Subway

Slides:

Advertisements

Similar presentations

Introduction 1.Ordering of P. knowlesi contigs v P. falciparum methodology progress/status towards a synteny map – ‘true’ scaffold 2. Gene prediction generating.

Advertisements

Blast outputoutput. How to measure the similarity between two sequences Q: which one is a better match to the query ? Query: M A T W L Seq_A: M A T P.

NCBI BLAST, CDD, Mini-courses Katia Guimarães 2007/2.

Bioinformatics Tutorial I BLAST and Sequence Alignment.

Sequence Analysis MUPGRET June workshops. Today What can you do with the sequence? What can you do with the ESTs? The case of SNP and Indel.

Alignment of mRNAs to genomic DNA Sequence Martin Berglund Khanh Huy Bui Md. Asaduzzaman Jean-Luc Leblond.

Sequence Analysis. Today How to retrieve a DNA sequence? How to search for other related DNA sequences? How to search for its protein sequence? How to.

Bioinformatics On Genomics Hsueh-Fen Yuki Juan April 28, 2003.

Sequence alignment, E-value & Extreme value distribution

Eukaryotic Gene Finding

Genome Annotation BCB 660 October 20, From Carson Holt.

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Making Sense of DNA and protein sequence analysis tools (course #2) Dave Baumler Genome Center of Wisconsin,

Wellcome Trust Workshop Working with Pathogen Genomes Module 3 Sequence and Protein Analysis (Using web-based tools)

Bioinformatics.

Cloning and Sequencing Explorer Series

BLAST What it does and what it means Steven Slater Adapted from pt.

Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.

Chapter 14 Genomes and Genomics. Sequencing DNA dideoxy (Sanger) method ddGTP ddATP ddTTP ddCTP 5’TAATGTACG TAATGTAC TAATGTA TAATGT TAATG TAAT TAA TA.

Tomato genome annotation pipeline in Cyrille2

Genome Annotation using MAKER-P at iPlant Collaboration with Mark Yandell Lab (University of Utah) iPlant: Josh Stein (CSHL) Matt Vaughn.

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

Genome Annotation BBSI July 14, 2005 Rita Shiang.

Introduction to Bioinformatics CPSC 265. Interface of biology and computer science Analysis of proteins, genes and genomes using computer algorithms and.

Tweaking BLAST Although you normally see BLAST as a web page with boxes to place data in and tick boxes, etc., it is actually a command line program that.

NCBI Review Concepts Chuong Huynh. NCBI Pairwise Sequence Alignments Purpose: identification of sequences with significant similarity to (a)

Blast 1. Blast 2 Low Complexity masking >GDB1_WHEAT MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQ QPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQI.

NGS Bioinformatics Workshop 1.5 Tutorial – Genome Annotation April 5th, 2012 IRMACS Facilitator: Richard Bruskiewich Adjunct Professor, MBB.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Module 3 Sequence and Protein Analysis (Using web-based tools) Working with Pathogen Genomes - Uruguay 2008.

ANALYSIS AND VISUALIZATION OF SINGLE COPY ORTHOLOGS IN ARABIDOPSIS, LETTUCE, SUNFLOWER AND OTHER PLANT SPECIES. Alexander Kozik and Richard W. Michelmore.

Part I: Identifying sequences with … Speaker : S. Gaj Date

Genome databases and webtools for genome analysis Become familiar with microbial genome databases Use some of the tools useful for analyzing genome Visit.

Welcome to DNA Subway Classroom-friendly Bioinformatics.

BLAST Anders Gorm Pedersen & Rasmus Wernersson. Database searching Using pairwise alignments to search databases for similar sequences Database Query.

BLAST Basic Local Alignment Search Tool (Altschul et al. 1990)

Biological Databases Biology outside the lab. Why do we need Bioinfomatics? Over the past few decades, major advances in the field of molecular biology,

Construction of Substitution Matrices

Genome Annotation Rosana O. Babu.

Srr-1 from Streptococcus. i/v nonpolar s serine (polar uncharged) n/s/t polar uncharged s serine (polar uncharged) e glutamic acid (neg. charge) sserine.

Mark D. Adams Dept. of Genetics 9/10/04

Eukaryotic Gene Prediction Rui Alves. How are eukaryotic genes different? DNA RNA Pol mRNA Ryb Protein.

How can we find genes? Search for them Look them up.

JIGSAW: a better way to combine predictions J.E. Allen, W.H. Majoros, M. Pertea, and S.L. Salzberg. JIGSAW, GeneZilla, and GlimmerHMM: puzzling out the.

Tweaking BLAST Although you normally see BLAST as a web page with boxes to place data in and tick boxes, etc., it is actually a command line program that.

SRB Genome Assembly and Analysis From 454 Sequences HC70AL S Brandon Le & Min Chen.

Bioinformatics zInterdisciplinary science that involves developing and applying information technology for analyzing biological data Overview of Bioinformatics.

Annotation of eukaryotic genomes

What is BLAST? Basic BLAST search What is BLAST?

BIOINFORMATICS Ayesha M. Khan Spring 2013 Lec-8.

Biotechnology and Bioinformatics: Bioinformatics Essential Idea: Bioinformatics is the use of computers to analyze sequence data in biological research.

Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.

Using DNA Subway in the Classroom Genome Annotation: Red Line.

1 Gene Finding. 2 “The Central Dogma” TranscriptionTranslation RNA Protein.

What is BLAST? Basic BLAST search What is BLAST?

bacteria and eukaryotes

Annotating The data.

Research Paper on BioInformatics

Basics of BLAST Basic BLAST Search - What is BLAST?

GEP Annotation Workflow

Genome Center of Wisconsin, UW-Madison

Bioinformatics and BLAST

Genome Editing with Apollo

Comparative Genomics.

Practice Clone 3 Download and get ready!.

Follow-up from last night: XSEDE credits

Basic Local Alignment Search Tool

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Presentation transcript:

Gene Annotation with DNA Subway

http://dnasubway.iplantcollaborative.org/ or Google ‘DNA Subway’

Google ‘ncbi’ or www.ncbi.nlm.nih.gov/

It is essential that the search for genes is done in regions that do not contain repetitive DNA.

It is essential that the search for genes is done in regions that do not contain repetitive DNA.

Gene predictors are inaccurate. FGenesH and SNAP are ab initio scripts (use the algorithm only). Augustus, is evidence-based, and tries to incorporate cDNA and EST data Augustus and FGenesH are better at finding intron/exon boundaries while SNAP tends to report genes as single exons.

Time to integrate more evidence Basic Local Alignment Search Tool or BLAST BLASTn- uses the 102 kb DNA sequence as a query against all the A. thaliana sequences in GenBank. BLASTx takes the 102 kb DNA and translates all six possible reading frames and uses all ORFs as a query against the GenBank proteins.

For students- Review Red Line with other clones. Analyze 50 kb of sequence:

End of Exercise 1