COURSE OF BIOINFORMATICS 2013-2014 Exam_30/01/2014 A.

Slides:

Advertisements

Similar presentations

Peter Tsai, Bioinformatics Institute.  University of California, Santa Cruz (UCSC)  A rapid and reliable display of any requested portion of genomes.

Advertisements

BIOINFORMATICS Ency Lee.

PROMoter SCanning/ANalysis tool. Goal Creating a tool to analyse a set of putative promoter sequences and recognize known and unknown promoters, with.

Kate Milova MolGen retreat March 24, Microarray experiments: Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Tutorial 5 Motif discovery.

Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Introduction to Bioinformatics - Tutorial no. 5 MEME – Discovering motifs in sequences MAST – Searching for motifs in databanks TRANSFAC – The Transcription.

Kate Milova MolGen retreat March 24, Microarray experiments. Database and Analysis Tools. Kate Milova cDNA Microarray Facility March 24, 2005.

Biological Motivation Gene Finding in Eukaryotic Genomes

Regulation of eukaryotic gene sequence expression

International Livestock Research Institute, Nairobi, Kenya. Introduction to Bioinformatics: NOV David Lynn (M.Sc., Ph.D.) Trinity College Dublin.

Rosalind Elsie Franklin  Biophysicist and crystallographer  X-ray diffraction images of DNA  Tobacco mosaic and polio viruses  (source: wikipedia)

Genome Annotation BBSI July 14, 2005 Rita Shiang.

Screening a Library Plate out library on nutrient agar in petri dishes. Up to 50,000 plaques or colonies per plate.

Anotation: Gene of which little is known What follows is a simulation of an orf page in the proposed graphical interface. The interface does not yet exist.

SPH 247 Statistical Analysis of Laboratory Data 1May 14, 2013SPH 247 Statistical Analysis of Laboratory Data.

is accessible at: The following pages are a schematic representation of how to navigate through ALE-HSA21.

UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.

발표자 석사 2 년 김태형 Vol. 11, Issue 3, , March 2001 Comparative DNA Sequence Analysis of Mouse and Human Protocadherin Gene Clusters 인간과 마우스의 PCDH 유전자.

COURSE OF BIOINFORMATICS Exam_31/01/2014 A.

Sequencing a genome and Basic Sequence Alignment

BIOINFORMATIK I UEBUNG 2 mRNA processing.

Web Databases for Drosophila Introduction to FlyBase and Ensembl Database Wilson Leung6/06.

Fea- ture Num- ber Feature NameFeature description 1 Average number of exons Average number of exons in the transcripts of a gene where indel is located.

Predicting protein degradation rates Karen Page. The central dogma DNA RNA protein Transcription Translation The expression of genetic information stored.

Sackler Medical School

Overview of Bioinformatics 1 Module Denis Manley..

Gene Prediction: Similarity-Based Methods (Lecture for CS498-CXZ Algorithms in Bioinformatics) Sept. 15, 2005 ChengXiang Zhai Department of Computer Science.

Motif discovery and Protein Databases Tutorial 5.

Using Exons to Define Isoforms in PRO Timothy Danford Novartis Institutes for Biomedical Research PRO / AlzForum Kickoff Meeting Oct. 4, 2011.

Gene Regulatory Networks and Neurodegenerative Diseases Anne Chiaramello, Ph.D Associate Professor George Washington University Medical Center Department.

Epidemiology 217 Molecular and Genetic Epidemiology Bioinformatics & Proteomics John Witte.

Cool BaRC Web Tools Prat Thiru. BaRC Web Tools We have.

What is so memorable about CREBBP? (RSTS; RTS, CBP CBP/MOZ FUSION GENE, CREB-binding protein)

EBI is an Outstation of the European Molecular Biology Laboratory. UniProtKB Sandra Orchard.

JIGSAW: a better way to combine predictions J.E. Allen, W.H. Majoros, M. Pertea, and S.L. Salzberg. JIGSAW, GeneZilla, and GlimmerHMM: puzzling out the.

-1- Module 3: RNA-Seq Module 3 BAMView Introduction Recently, the use of new sequencing technologies (pyrosequencing, Illumina-Solexa) have produced large.

Introduction to Bioinformatics - Tutorial no. 5 MEME – Discovering motifs in sequences MAST – Searching for motifs in databanks TRANSFAC – the Transcription.

Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.

1 Many to 1 Gene Associations The following slides show a few examples of gene predictions by one annotation group that overlap one or more genes from.

Finding genes in the genome

Accessing and visualizing genomics data

BIOINFORMATICS Ayesha M. Khan Spring 2013 Lec-8.

An example of GO annotation from a primary paper GO Annotation Camp, July 2006 PMID:

Welcome to the Protein Database Tutorial. This tutorial will describe how to navigate the section of Gramene that provides collective information on proteins.

Using public resources to understand associations Dr Luke Jostins Wellcome Trust Advanced Courses; Genomic Epidemiology in Africa, 21 st – 26 th June 2015.

Genetic Code and Interrupted Gene Chapter 4. Genetic Code and Interrupted Gene Aala A. Abulfaraj.

1 Gene Finding. 2 “The Central Dogma” TranscriptionTranslation RNA Protein.

Regulation of Gene Expression

Bioinformatics for Research

The Transcriptional Landscape of the Mammalian Genome

Promoters and expression

There are four levels of structure in proteins

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

What is an Ontology An ontology is a set of terms, relationships and definitions that capture the knowledge of a certain domain. (common ontology ≠ common.

Transcription Definition

Searching the NCBI Databases

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

Ensembl Genome Repository.

Heat Shock Factor Protein Family of Transcription Factors

Structure of the Genome

Gene Safari (Biological Databases)

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

Problems from last section

Identification of FOXP2 Truncation as a Novel Cause of Developmental Speech and Language Deficits Kay D. MacDermot, Elena Bonora, Nuala Sykes, Anne-Marie.

iraL shares sequence identity with iraM from E

The Gene Mutated in Variant Late-Infantile Neuronal Ceroid Lipofuscinosis (CLN6) and in nclf Mutant Mice Encodes a Novel Predicted Transmembrane Protein

Identification of acetylated peptides and proteins by LC-MS/MS.

KEY CONCEPT Entire genomes are sequenced, studied, and compared.

Presentation transcript:

COURSE OF BIOINFORMATICS Exam_30/01/2014 A

Insert the requested information: Name and Surname: Matricula Number: address: (I will contact you at this address!!)

Human ACOX3 gene

Slide 1 remember to annotate the source of the information 1.Report the Gene_ID, the chromosomal and genomic (in bp) localization of the human ACOX3 gene 2.How many different transcript isoforms exist for the ACOX3 gene? Do they differ in their ending point (i.e.: last exon)? 3.Is the ACOX3 gene involved in the etiology of any disorders? If yes, annotate disorder name and corresponding MIM number 1.Which are the genes contained in the genomic region spanning 50 kb upstream and 50 kb downstream to the ACOX3 gene? Is there any difference between RefSeq genes and UCSC genes?Annotate the official Gene symbols and the Gene_IDs of RefSeq genes in the region.

Slide 2 remember to annotate the source of the information 5.In the genomic region previously defined, could you identify a CpG island putatively involved in the transcriptional regulation of the ACOX3 gene? Describe some of the main features of the CpG island identified. 6.In your opinion, does the identified CpG island physically overlap with any other genomic DNA feature suggestive of transcriptional regulation? 7.Report the Accession code of the reviewed ACOX3 protein. Which protein domains, if any, are reported and where are they localized? 8.Could you find a murine homologue of the human ACOX3 gene? Annotate its GeneID and its genomic location.

Slide 3 remember to annotate the source of the information 9.Do a multiple sequence alignment with the following amino acid sequences (suggestion: use ClustalW2). In your opinion, which is the region showing the higher level of identity? 10.Retrieve the Accession numbers of the complete sequences from which each of the above fragments was extracted and the species they belong to. >ACOX3_seq1 MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSP >ACOX3_seq2 MGSLPEEKDSALWSDTPKGPLSAYRARASFNSGELLLFWDGQDVIHFKKTIFSTLENDPLFARSY >ACOX3_seq3 MDEGIPDFPNGPLDIYRKKASFSWKDMMRFLEGDELIAFKQHVFRTLESDPLFARQPGEDVPVEQ

Slide 4 remember to annotate the source of the information 11.Using the Gene Ontology database could you infer the cellular component, the biological process and the molecular function of ACOX3 gene? Recontruct the ontology of the GO terms in each of the three categories in which the ACOX3 gene is annotated.

Slide 5 remember to annotate the source of the information 12.In the ACOX3 3’ UTR, can you recognize any miRNAs binding sites predicted by at least two different algorithms? Annotate names, binding site position and the accession codes for some of the predicted miRNA.