Presentation is loading. Please wait.

Presentation is loading. Please wait.

Introduction to Bioinformatics

Similar presentations


Presentation on theme: "Introduction to Bioinformatics"— Presentation transcript:

1 Introduction to Bioinformatics

2 What is Bioinformatics?

3 NIH – definitions What is Bioinformatics? - Research, development, and application of computational tools and approaches for expanding the use of biological, medical, behavioral, and health data, including the means to acquire, store, organize, archive, analyze, or visualize such data. What is Computational Biology? - The development and application of analytical and theoretical methods, mathematical modeling and computational simulation techniques to the study of biological, behavioral, and social data.

4 NSF – introduction Large databases that can be accessed and analyzed with sophisticated tools have become central to biological research and education. The information content in the genomes of organisms, in the molecular dynamics of proteins, and in population dynamics, to name but a few areas, is enormous. Biologists are increasingly finding that the management of complex data sets is becoming a bottleneck for scientific advances. Therefore, bioinformatics is rapidly become a key technology in all fields of biology.

5 NSF – mission statement
The present bottlenecks in bioinformatics include the education of biologists in the use of advanced computing tools, the recruitment of computer scientists into this evolving field, the limited availability of developed databases of biological information, and the need for more efficient and intelligent search engines for complex databases.

6 NSF – mission statement
The present bottlenecks in bioinformatics include the education of biologists in the use of advanced computing tools, the recruitment of computer scientists into this evolving field, the limited availability of developed databases of biological information, and the need for more efficient and intelligent search engines for complex databases.

7 Molecular Bioinformatics
Molecular Bioinformatics involves the use of computational tools to discover new information in complex data sets (from the one-dimensional information of DNA through the two-dimensional information of RNA and the three-dimensional information of proteins, to the four-dimensional information of evolving living systems).

8 From DNA to Genome Sanger sequences insulin protein
Watson and Crick DNA model Sanger sequences insulin protein Sanger dideoxy DNA sequencing PCR (Polymerase Chain Reaction) 1955 ARPANET (early Internet) PDB (Protein Data Bank) Sequence alignment GenBank database Dayhoff’s Atlas 1960 1965 1970 1975 1980 1985

9 Human Genome Initiative
SWISS-PROT database NCBI World Wide Web BLAST FASTA EBI Human Genome Initiative First human genome draft First bacterial genome Yeast genome 1990 1995 2000

10 Origin of bioinformatics and biological databases:
The first protein sequence reported was that of bovine insulin in 1956, consisting of 51 residues. Nearly a decade later, the first nucleic acid sequence was reported, that of yeast tRNAalanine with 77 bases.

11 In 1965, Dayhoff gathered all the available sequence data to create the first bioinformatic database (Atlas of Protein Sequence and Structure). The Protein DataBank followed in 1972 with a collection of ten X-ray crystallographic protein structures. The SWISSPROT protein sequence database began in 1987.

12 Nucleotides

13 Complete Genomes • 1994 0 • 1995 1 • December 2006 376 Eukaryotes 22
• December Eukaryotes Bacteria Archaea

14 What can we do with sequences and other type of molecular information?

15 Open reading frames Functional sites Annotation Structure, function

16 CCTGACAAATTCGACGTGCGGCATTGCATGCAGACGTGCATG
CGTGCAAATAATCAATGTGGACTTTTCTGCGATTATGGAAGAA CTTTGTTACGCGTTTTTGTCATGGCTTTGGTCCCGCTTTGTTC AGAATGCTTTTAATAAGCGGGGTTACCGGTTTGGTTAGCGAGA AGAGCCAGTAAAAGACGCAGTGACGGAGATGTCTGATG CAA TAT GGA CAA TTG GTT TCT TCT CTG AAT TGAAAAACGTA

17 promoter TF binding site Transcription Start Site
CCTGACAAATTCGACGTGCGGCATTGCATGCAGACGTGCATG CGTGCAAATAATCAATGTGGACTTTTCTGCGATTATGGAAGAA CTTTGTTACGCGTTTTTGTCATGGCTTTGGTCCCGCTTTGTTC AGAATGCTTTTAATAAGCGGGGTTACCGGTTTGGTTAGCGAGA AGAGCCAGTAAAAGACGCAGTGACGGAGATGTCTGATG CAA TAT GGA CAA TTG GTT TCT TCT CTG AAT TGAAAAACGTA Transcription Start Site Ribosome binding Site ORF = Open Reading Frame CDS = Coding Sequence

18 Comparative genomics Comparing ORFs Identifying orthologs
Inferences on structure and function Comparative genomics Comparing functional sites Inferences on regulatory networks

19 Similarity profiles Researchers can learned a great deal about the structure and function of human genes by examining their counterparts in model organisms.

20 Alignment preproinsulin
Xenopus MALWMQCLP-LVLVLLFSTPNTEALANQHL Bos MALWTRLRPLLALLALWPPPPARAFVNQHL **** : * *.*: *:..* :. *:**** Xenopus CGSHLVEALYLVCGDRGFFYYPKIKRDIEQ Bos CGSHLVEALYLVCGERGFFYTPKARREVEG ***************:***** ** :*::* Xenopus AQVNGPQDNELDG-MQFQPQEYQKMKRGIV Bos PQVG---ALELAGGPGAGGLEGPPQKRGIV .**. ** * * ***** Xenopus EQCCHSTCSLFQLENYCN Bos EQCCASVCSLYQLENYCN **** *.***:*******

21

22 Ultraconserved Elements in the Human Genome
Gill Bejerano, Michael Pheasant, Igor Makunin, Stuart Stephen, W. James Kent, John S. Mattick, & David Haussler (Science : ) There are 481 segments longer than 200 base pairs (bp) that are absolutely conserved (100% identity with no insertions or deletions) between orthologous regions of the human, rat, and mouse genomes. Nearly all of these segments are also conserved in the chicken and dog genomes, with an average of 95 and 99% identity, respectively. Many are also significantly conserved in fish. These ultraconserved elements of the human genome are most often located either overlapping exons in genes involved in RNA processing or in introns or nearby genes involved in the regulation of transcription and development. There are 156 intergenic, untranscribed, ultraconserved segments

23 Junk: Supporting evidence Junk is real!

24 Functional genomics Genome-wide profiling of: • mRNA levels
• Protein levels Co-expression of genes and/or proteins Functional genomics Identifying protein-protein interactions Networks of interactions

25 Understanding the function of genes and other parts of the genome

26 Structural genomics Assign structure to all proteins encoded in
a genome

27 Structural Genomics Currently ~300 ~300 unique folds unique folds
in PDB ~300 unique folds 27761 structures Currently

28 Structural Genomics Estimate 1000-3000 unique folds
in “structure space” Estimate

29 Origin of tools Immediately after the establishment of the first databases, tools became available to search them - at first in a very simple manner, looking for keyword matches and short sequence words and, then, in a more sophisticated manner by using pattern matching, alignment based methods, and machine learning techniques.

30 Despite the huge explosion in the number and length of sequences, the tools used for storage, retrieval, analysis, and dissemination of data in bioinformatics are very similar to those from years ago.

31 Biological databases

32 Database or databank? Initially Solution Databank (in UK)
Database (in the USA) Solution The abbreviation db

33 What is a database? A collection of data
structured searchable (index) -> table of contents updated periodically (release) -> new edition cross-referenced (hyperlinks) -> links with other db Includes also associated tools (software) necessary for access, updating, information insertion, information deletion…. Data storage management: flat files, relational databases…

34 Database: a « flat file » example
Flat-file database («  flat file, 3 entries  »): Accession number: 1 First Name: Amos Last Name: Bairoch Course: Pottery 2000; Pottery 2001; // Accession number: 2 First Name: Dan Last name: Graur Course: Pottery 2000, Pottery 2001; Ballet 2001, Ballet 2002 Accession number 3: First Name: John Last name: Travolta Course: Ballet 2001; Ballet 2002; Easy to manage: all the entries are visible at the same time !

35 Database: a « relational » example
Relational database (« table file »): Teacher Accession number Education Amos 1 Biochemistry Dan 2 Genetics John 3 Scientology Course Year Involved teachers Advanced Pottery 2000; 2001 1; 2 Ballet for Fat People 2001; 2002 2; 3

36 Why biological databases?
Exponential growth in biological data. Data (genomic sequences, 3D structures, 2D gel analysis, MS analysis, Microarrays….) are no longer published in a conventional manner, but directly submitted to databases. Essential tools for biological research.

37 Distribution of sequences
Books, articles > 1985 Computer tapes > 1992 Floppy disks > 1990 CD-ROM > FTP > On-line services > 1994 WWW > DVD >

38 Some statistics More than 1000 different ‘biological’ databases
Variable size: <100Kb to >20Gb DNA: > 20 Gb Protein: 1 Gb 3D structure: 5 Gb Other: smaller Update frequency: daily to annually to seldom to forget about it. Usually accessible through the web (some free, some not)

39 Some databases in the field of molecular biology…
AATDB, AceDb, ACUTS, ADB, AFDB, AGIS, AMSdb, ARR, AsDb, BBDB, BCGD, Beanref, Biolmage, BioMagResBank, BIOMDB, BLOCKS, BovGBASE, BOVMAP, BSORF, BTKbase, CANSITE, CarbBank, CARBHYD, CATH, CAZY, CCDC, CD4OLbase, CGAP, ChickGBASE, Colibri, COPE, CottonDB, CSNDB, CUTG, CyanoBase, dbCFC, dbEST, dbSTS, DDBJ, DGP, DictyDb, Picty_cDB, DIP, DOGS, DOMO, DPD, DPlnteract, ECDC, ECGC, EC02DBASE, EcoCyc, EcoGene, EMBL, EMD db, ENZYME, EPD, EpoDB, ESTHER, FlyBase, FlyView, GCRDB, GDB, GENATLAS, Genbank, GeneCards, Genline, GenLink, GENOTK, GenProtEC, GIFTS, GPCRDB, GRAP, GRBase, gRNAsdb, GRR, GSDB, HAEMB, HAMSTERS, HEART-2DPAGE, HEXAdb, HGMD, HIDB, HIDC, HlVdb, HotMolecBase, HOVERGEN, HPDB, HSC-2DPAGE, ICN, ICTVDB, IL2RGbase, IMGT, Kabat, KDNA, KEGG, Klotho, LGIC, MAD, MaizeDb, MDB, Medline, Mendel, MEROPS, MGDB, MGI, MHCPEP5 Micado, MitoDat, MITOMAP, MJDB, MmtDB, Mol-R-Us, MPDB, MRR, MutBase, MycDB, NDB, NRSub, 0-lycBase, OMIA, OMIM, OPD, ORDB, OWL, PAHdb, PatBase, PDB, PDD, Pfam, PhosphoBase, PigBASE, PIR, PKR, PMD, PPDB, PRESAGE, PRINTS, ProDom, Prolysis, PROSITE, PROTOMAP, RatMAP, RDP, REBASE, RGP, SBASE, SCOP, SeqAnaiRef, SGD, SGP, SheepMap, Soybase, SPAD, SRNA db, SRPDB, STACK, StyGene,Sub2D, SubtiList, SWISS-2DPAGE, SWISS-3DIMAGE, SWISS- MODEL Repository, SWISS-PROT, TelDB, TGN, tmRDB, TOPS, TRANSFAC, TRR, UniGene, URNADB, V BASE, VDRR, VectorDB, WDCM, WIT, WormPep, YEPD, YPD, YPM, etc !!!!

40 Categories of databases for Life Sciences
Sequences (DNA, protein) Genomics Mutation/polymorphism Protein domain/family Proteomics (2D gel, Mass Spectrometry) 3D structure Metabolism Bibliography Expression (Microarrays,…) Specialized

41 Resources NCBI (National Center for Biotechnology Information) is a resource for molecular biology information. NCBI creates and maintains public databases, conducts research in computational biology, develops software tools for analyzing genome data, and disseminates biomedical information. The NCBI site is constantly being updated and some of the changes include new databases and tools for data mining. NCBI offers several searchable literature, molecular and genomic databases and many bioinformatic tools. An up-to-date list of databases and tools can be found on the NCBI Sitemap.

42 Literature Databases:
Bookshelf: A collection of searchable biomedical books linked to PubMed. PubMed: Allows searching by author names, journal titles, and a new Preview/Index option. PubMed database provides access to over 12 million MEDLINE citations back to the mid-1960's. It includes History and Clipboard options which may enhance your search session. PubMed Central: The U.S. National Library of Medicine digital archive of life science journal literature. OMIM: Online Mendelian Inheritance in Man is a database of human genes and genetic disorders (also OMIA).

43 GenBank: http://www.ncbi.nlm.nih.gov/Genbank/
EBI: DDBJ:

44 Type in a Query term Enter your search words in the
query box and hit the “Go” button

45 The Syntax … Boolean operators: AND, OR, NOT must be entered in UPPERCASE (e.g., promoters OR response elements). The default is AND. 2. Entrez processes all Boolean operators in a left-to-right sequence. The order in which Entrez processes a search statement can be changed by enclosing individual concepts in parentheses. The terms inside the parentheses are processed first. For example, the search statement: g1p3 OR (response AND element AND promoter). 3. Quotation marks: The term inside the quotation marks is read as one phrase (e.g. “public health” is different than public health, which will also include articles on public latrines and their effect on health workers). 4. Asterisk: Extends the search to all terms that start with the letters before the asterisk. For example, dia* will include such terms as diaphragm, dial, and diameter.

46

47 Refine the Query Often a search finds too many (or too few) sequences, so you can go back and try again with more (or fewer) keywords in your query The “History” feature allows you to combine any of your past queries. The “Limits” feature allows you to limit a query to specific organisms, sequences submitted during a specific period of time, etc. [Many other features are designed to search for literature in MEDLINE]

48 Related Items You can search for a text term in sequence annotations or in MEDLINE abstracts, and find all articles, DNA, and protein sequences that mention that term. Then from any article or sequence, you can move to "related articles" or "related sequences". Relationships between sequences are computed with BLAST Relationships between articles are computed with "MESH" terms (shared keywords) Relationships between DNA and protein sequences rely on accession numbers Relationships between sequences and MEDLINE articles rely on both shared keywords and the mention of accession numbers in the articles.

49

50

51

52 Database Search Strategies
General search principles - not limited to sequence (or to biology). Start with broad keywords and narrow the search using more specific terms. Try variants of spelling, numbers, etc. Search many databases. Be persistent!!

53 PubMed MEDLINE publication database Papers from 1960 and on
Over 17,000 journals Some other citations Papers from 1960 and on Over 12,000,000 entries Alerting services

54 Searching PubMed Structureless searches Structured searches
Automatic term mapping Structured searches Tags, e.g. [au], [ta], [dp], [ti] Boolean operators, e.g. AND, OR, NOT, () Additional features Subsets, limits Clipboard, history

55 (cuba* cigar*) NOT smok* Fidel Castro “fidel castro” #6 NOT #7
Start working: Search PubMed cuban cigars cuban OR cigars “cuban cigars” cuba* cigar* (cuba* cigar*) NOT smok* Fidel Castro “fidel castro” #6 NOT #7

56 “Details” and “History” in PubMed

57 “Details” and “History” in PubMed

58 The OMIM (Online Mendelian Inheritance in Man)
Genes and genetic disorders Edited by team at Johns Hopkins Updated daily

59 * gene with known sequence + gene with known sequence and phenotype
MIM Number Prefixes * gene with known sequence gene with known sequence and phenotype # phenotype description, molecular basis known % mendelian phenotype or locus, molecular basis unknown no prefix other, mainly phenotypes with suspected mendelian basis

60 Searching OMIM Search Fields Name of trait, e.g., hypertension
Cytogenetic location, e.g., 1p31.6 Inheritance, e.g., autosomal dominant Gene, e.g., coagulation factor VIII

61 OMIM search tags All Fields [ALL] Allelic Variant [AV] or [VAR] Chromosome [CH] or [CHR] Clinical Synopsis [CS] or [CLIN] Gene Map [GM] or [MAP] Gene Name [GN] or [GENE] Reference [RE] or [REF]

62

63 How many types of hemophilia are there?
Start working: Search OMIM How many types of hemophilia are there? For how many is the affected gene known? What are the genes involved in hemophilia A? What are the mutations in hemophilia A?

64 Online Literature databases
1. How to use the UH online Library? 2. Online glossaries 3. Google Scholar 4. Google Books 5. Web of Science

65 How to use the online UH Library?

66

67 Online Glossaries Bioinformatics :
Genomics: Molecular Evolution: Biology dictionary: Other glossaries, e.g., the list of phobias:

68 4. Google Scholar

69 What is Google Scholar? Enables you to search specifically for scholarly literature, including peer-reviewed papers, theses, books, preprints, abstracts and technical reports from all broad areas of research.

70 Use Google Scholar to find articles from a wide variety of academic publishers, professional societies, preprint repositories and universities, as well as scholarly articles available across the web.

71 Google Scholar orders your search results by how relevant they are to your query, so the most useful references should appear at the top of the page This relevance ranking takes into account the: full text of each article. the article's author, the publication in which the article appeared and how often it has been cited in scholarly literature.

72 What other DATA can we retrieve from the record?

73 This option will lunch regular Google

74

75 5. Google Book Search

76

77 Start working: Search Google Books How many times is the tail of the giraffe mentioned in On the Origin of Species by Mr. Darwin?

78 6. Web of science

79

80


Download ppt "Introduction to Bioinformatics"

Similar presentations


Ads by Google