Presentation is loading. Please wait.

Presentation is loading. Please wait.

Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.

Published byRidwan Kurniawan Modified over 4 years ago

Similar presentations

Presentation on theme: "Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human."— Presentation transcript:

1 Multiple alignment of type I and III IFNs from Xenopus, chicken, and human.
Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. The alignment was generated by CLUSTALW using full-length protein sequences. The putative signal peptide sequences predicted by SignalP are underlined. Conserved cysteines are shadowed and predicted glycosylation sites are in bold. Intron positions are indicated by arrows and numbered above or below the alignment. Zhitao Qi et al. J Immunol 2010;184: Copyright © 2010 by The American Association of Immunologists, Inc.

Download ppt "Multiple alignment of type I and III IFNs from Xenopus, chicken, and human. Multiple alignment of type I and III IFNs from Xenopus, chicken, and human."

Similar presentations

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.

Figure 1. Structure of the fly LGR2 gene and the corresponding cDNA sequence. A, Derivation of the fly LGR2 full-length cDNA from the genomic sequence.
Sequence based searches:

Sequence based searches:
Volume 88, Issue 5, Pages (March 1997)

Volume 88, Issue 5, Pages (March 1997)
Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p 9.0101, GenBank accession.

Fig. 1. (A) The nucleotide and deduced amino acid sequences of the vacuolar serine protease protein of F. proliferatum (Fus p , GenBank accession.
Activation of NK cells during the early stage of allergic and fibrotic lung inflammation. Activation of NK cells during the early stage of allergic and.

Activation of NK cells during the early stage of allergic and fibrotic lung inflammation. Activation of NK cells during the early stage of allergic and.
Anti-CD40 and CpG induce activation of T cells in draining lymph nodes

Anti-CD40 and CpG induce activation of T cells in draining lymph nodes
Sequence and comparison of the SDS protein.

Sequence and comparison of the SDS protein.
GASing up iron delivery via STAT5

GASing up iron delivery via STAT5
Characterization of Siglec-5, a Novel Glycoprotein Expressed on Myeloid Cells Related to CD33 by Ann L. Cornish, Sylvie Freeman, Gareth Forbes, Jian Ni,

Characterization of Siglec-5, a Novel Glycoprotein Expressed on Myeloid Cells Related to CD33 by Ann L. Cornish, Sylvie Freeman, Gareth Forbes, Jian Ni,
Alignment of distal NOS2 promoters from cattle, human, and sheep, and the Bov-A2 element. Alignment of distal NOS2 promoters from cattle, human, and sheep,

Alignment of distal NOS2 promoters from cattle, human, and sheep, and the Bov-A2 element. Alignment of distal NOS2 promoters from cattle, human, and sheep,
Expression and regulation of MD-2s.

Expression and regulation of MD-2s.
LP-BM5–induced increases of cytokine levels in the hind paw skin of B6 mice. LP-BM5–induced increases of cytokine levels in the hind paw skin of B6 mice.

LP-BM5–induced increases of cytokine levels in the hind paw skin of B6 mice. LP-BM5–induced increases of cytokine levels in the hind paw skin of B6 mice.
The Haystack Is Full of Needles: Technology Rescues Sugars!

The Haystack Is Full of Needles: Technology Rescues Sugars!
Classification of Introns: U2-Type or U12-Type

Classification of Introns: U2-Type or U12-Type
Secretin and vasoactive intestinal peptide receptors: Members of a unique family of G protein–coupled receptors  Charles D. Ulrich, Martin Holtmann‡,

Secretin and vasoactive intestinal peptide receptors: Members of a unique family of G protein–coupled receptors  Charles D. Ulrich, Martin Holtmann‡,
Volume 88, Issue 5, Pages (March 1997)

Volume 88, Issue 5, Pages (March 1997)
Novel phosphorylation sites on H+-ATPase proteins

Novel phosphorylation sites on H+-ATPase proteins
Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.

Figure 1: The full-length cDNA and deduced amino acid sequences of Lysozyme C and amino acid sequences from rock bream, Oplegnathus fasciatus. The primers.
Figure 2 Schematic displaying the 3 described CHT mutant proteins alongside wild type molecule (Adapted from reference 2, using Microsoft Powerpoint Software)‏

Figure 2 Schematic displaying the 3 described CHT mutant proteins alongside wild type molecule (Adapted from reference 2, using Microsoft Powerpoint Software)‏

Similar presentations

Ads by Google