SRB Genome Assembly and Analysis From 454 Sequences HC70AL S09 04-21-09 Brandon Le & Min Chen.

Slides:

Advertisements

Similar presentations

Genomics: READING genome sequences ASSEMBLY of the sequence ANNOTATION of the sequence carry out dideoxy sequencing connect seqs. to make whole chromosomes.

Advertisements

Welcome to the Gramene BLAST Tutorial This tutorial will show you how to conduct a BLAST search. With BLAST you may: –Search for sequence similarity matches.

Vertebrate natural history in the 21 st century: genetics, ecology, and evolution Andrew DeWoody Purdue University.

Bioinformatics Tutorial I BLAST and Sequence Alignment.

Annotating a Scarlet Runner Bean genome fragment put together by shotgun sequencing Scarlet Runner ean Max Bachour.

The Scarlet Runner Bean Genome: Contig By Eden Maloney.

Max BachourJessica Chen. Shotgun or 454 sequencing High throughput sequencing technique that can collect a large amount of data at a fast rate. Works.

HC70AL Spring 2009 An Introduction to Bioinformatics By Brandon Le & Min Chen April 7, 2009.

Scarlet Runner Bean Genome Assembly Nancy Phang June 4, 2004.

Gene Prediction Methods G P S Raghava. Prokaryotic gene structure ORF (open reading frame) Start codon Stop codon TATA box ATGACAGATTACAGATTACAGATTACAGGATAG.

Sequence Analysis MUPGRET June workshops. Today What can you do with the sequence? What can you do with the ESTs? The case of SNP and Indel.

BME 130 – Genomes Lecture 7 Genome Annotation I – Gene finding & function predictions.

Genome Evolution: Duplication (Paralogs) & Degradation (Pseudogenes)

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Thanks for volunteering for our study. Your chart says you have problems eating, facial weakness and overall poor muscle tone. Looks like your mother had.

Making Sense of DNA and protein sequence analysis tools (course #2) Dave Baumler Genome Center of Wisconsin,

Sequence Analysis with Artemis & Artemis Comparison Tool (ACT) South East Asian Training Course on Bioinformatics Applied to Tropical Diseases (Sponsored.

Wellcome Trust Workshop Working with Pathogen Genomes Module 3 Sequence and Protein Analysis (Using web-based tools)

Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.

Tomato genome annotation pipeline in Cyrille2

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

Kerstin Howe, Mario Caccamo, Ian Sealy The Zebrafish Genome Sequencing Project Bioinformatics resources.

Tweaking BLAST Although you normally see BLAST as a web page with boxes to place data in and tick boxes, etc., it is actually a command line program that.

Blast 1. Blast 2 Low Complexity masking >GDB1_WHEAT MKTFLVFALIAVVATSAIAQMETSCISGLERPWQQQPLPPQQSFSQQPPFSQQQQQPLPQ QPSFSQQQPPFSQQQPILSQQPPFSQQQQPVLPQQSPFSQQQQLVLPPQQQQQQLVQQQI.

HC70AL Final Presentation Chris McQuilkin June 4 th, 2009.

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

ANALYSIS AND VISUALIZATION OF SINGLE COPY ORTHOLOGS IN ARABIDOPSIS, LETTUCE, SUNFLOWER AND OTHER PLANT SPECIES. Alexander Kozik and Richard W. Michelmore.

UMR ASP UMR ASP Structural & Comparative Genomics in Bread Wheat TriAnnotPipeline A LifeGrid Project based on AUVERGRID F. Giacomoni, M.

Welcome to DNA Subway Classroom-friendly Bioinformatics.

I. Introduction and Red Line Education for Data-unlimited Science.

1 P6a Extra Discussion Slides Part 1. 2 Section A.

BLAST Basic Local Alignment Search Tool (Altschul et al. 1990)

NCBI resources II: web-based tools and ftp resources Yanbin Yin Fall 2014 Most materials are downloaded from ftp://ftp.ncbi.nih.gov/pub/education/ 1.

15 January 2006, PAG XIV SanDiegoRémy Bruggmann, MIPS/IBI, GSF A Bioinformatic Framework to Unravel the Secrets of the Tomato Genome.

Gene Prediction and Phylogenetic Trees

Web Databases for Drosophila Introduction to FlyBase and Ensembl Database Wilson Leung6/06.

Basic Local Alignment Search Tool BLAST Why Use BLAST?

Genome annotation and search for homologs. Genome of the week Discuss the diversity and features of selected microbial genomes. Link to the paper describing.

Genomics Education Partnership: a flexible approach to implement Genomic teachings and research in the classroom Matthew W. Wadsworth and Consuelo J. Alvarez,

Annotation of Drosophila virilis Chris Shaffer GEP workshop, 2006.

Fgenes++ pipelines for automatic annotation of eukaryotic genomes Victor Solovyev, Peter Kosarev, Royal Holloway College, University of London Softberry.

David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.

Annotation of eukaryotic genomes

What is BLAST? Basic BLAST search What is BLAST?

BIOINFORMATICS Ayesha M. Khan Spring 2013 Lec-8.

Gene Finding in Chimpanzee Evidence based improvement of ab initio gene predictions Chris Shaffer06/2009.

Chapter 5 Sequence Assembly: Assembling the Human Genome.

454 Genome Sequence Assembly and Analysis HC70AL S Brandon Le & Min Chen.

Welcome to the combined BLAST and Genome Browser Tutorial.

Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.

Bioinformatics Computing 1 CMP 807 – Day 4 Kevin Galens.

Bioinformatics What is a genome? How are databases used? What is a phylogentic tree?

What is BLAST? Basic BLAST search What is BLAST?

Annotation for D. virilis

Gapless genome assembly of Colletotrichum higginsianum reveals chromosome structure and association of transposable elements with secondary metabolite.

Basics of BLAST Basic BLAST Search - What is BLAST?

Saccharomyces Genome Database (SGD)

GEP Annotation Workflow

Genome Center of Wisconsin, UW-Madison

Bioinformatics and BLAST

HC70AL Final Presentation

Gene Annotation with DNA Subway

RIKEN Arabidopsis Transposon-tagged Mutant (RATM) Line Catalogue Database USER’S GUIDE.

Comparative Genomics.

Basic Local Alignment Search Tool

Basic Local Alignment Search Tool (BLAST)

Basic Local Alignment Search Tool

Common Errors in Student Annotation Submissions contributions from Paul Lee, David Xiong, Thomas Quisenberry Annotating multiple genes at the same locus.

Presentation transcript:

SRB Genome Assembly and Analysis From 454 Sequences HC70AL S Brandon Le & Min Chen

Shotgun Genome Sequencing original DNA 454 Sequencing Sequence Analysis Begins!!! fragmented DNA REPEAT 1

Genome Sequence Analysis - Step Two Determine Open Reading Frame CONTIG 1 CONTIG 3 CONTIG 5 CONTIG 2 CONTIG 4 Assembled DNA Sequence GENE 1 GENE 2 Identify ORF

SRB Genome Information Genome Information Genome Size670 Mb a Number of Chromosomes11 Ploidy2n a. Broughton et al. (2003) Beans (Phaseolus spp.) – model food legumesPlant and Soil. Sequencing Information # of Sequences802,779 Total # of Sequenced Bases 291,416,275 Avg. Read Length363 Assembly Information # of Contigs81,888 # of Reads in Contigs 415,891 Largest Contig Size 20,991

GENSCAN Select Organism (Vertebrate, Arabidopsis, Maize) 33. Copy and Paste Sequence 22. Print Options (Predicted peptides only) (Predicted CDS and peptides) 44. Click Run GENSCAN

GENSCAN Output Predicted Genes Gene Structure

FGENESH 11. Copy and Paste Sequence 22. Organism (Select Dicot plants(Arabidopsis) (Medicago (legume plant)) 33. Click SEARCH

FGENESH Output Predicted Peptide Predicted Coding Sequence

GENEMARK.HMM 11. Copy and Paste Sequence 22. Species (A. thaliana ES-3.0) (M. truncatula ES-3.0) 33. Check Box Check Generate Postscript graphics Check Generate PDF graphics Translate predicted genes into protein Click Start GeneMark.hmm

GENEMARK.HMM Output Predicted Peptide

REPEAT MASKER 11. Copy and Paste Sequence 22. DNA Source (Arabidopsis thaliana) Submit Sequence

REPEAT MASKER OUTPUT 11. Number of Retroelements 22. Number of DNA Transposons 33. Simple Repeats

PLANT REPEAT DATABASE 22. Copy and Paste Sequence 33. Select BLAST Database (Brassicaceae Repeats) (Fabaceae Repeats) Submit BLAST Search 11. Select BLAST program (blastn) (blastp) (blastx)

BLAST OUTPUT PLANT REPEAT DATABASE OUTPUT Top BLAST HIT Sequence Alignment