It's usually difficult to identify a protein of interest in a Commassie Blue-stained gel of cell extracts Coomassie Blue-stained gel MW stds. Cell extracts.

Slides:



Advertisements
Similar presentations
Antibodies Analytical Techniques Utilizing Antibodies: flow cytometry
Advertisements

Recombinant Expression of PDI in E. coli
Western Analysis Laboratory procedure that allows you to:
Presented by: MUFIDATUR ROSYIDAH ( )
ABE Summer Workshop 2005 Southern & Western Blotting.
Immunolocalization for EM Using immunoglobulin molecules as tags for select proteins and carbohydrates. Visualized by using colloidal gold or enzyme reactions.
Protein Gel Electrophoresis
Introduction to Immunoassays
Chapter 10: Analysis of proteins. Purification schemes: 1. soluble recombinant proteins 2. insoluble recombinant proteins that are produced as inclusion.
Protein-protein interactions and western blotting MCB 130L Lecture 3.
Enzyme-linked Immunosorbent Assay
Chapter 3-Contd. Western blotting & SDS-PAGE
Altogen Labs, 4020 S Industrial Dr, Suite 130, Austin TX 78744, USA  ELIS A Enzyme-Linked Immunosorbent Assay ELISA.
Enzyme-Linked Immunosorbent Assay ELISA 1Dr. Nikhat Siddiq.
Lab#6 Western Blotting BCH 462[practical].
Lab 24 Goals and Objectives: EDVOKIT#271: Simulation of HIV-1 Detection: ELISA Work in pairs: ten groups possible Perform as indicated (supplemental packet.
Staining Techniques Histochemical Stains: involve chemical reactions Feulgen reaction -DNA Periodic Acid Shiff (PAS) -neutral and acidic polysaccharides.
Variations in the ELISA technique Used for testing the amount of antibody to an antigen in serum Lab 6. Preparation of rabbit IgG Enzyme linked Immunosorbent.
1 Talk Outline  Excerpt from talk given Nov 06 at the American Electrophoresis Society meeting in San Francisco  P-Serine & P-Threonine Western blotting.
Expression, Purification and Isolation of the MinE protein By Arsalan Wasim and Nicholas Wong.
Western Blotting.
Chapter 20 Experimental Systems Dr. Capers.  In vivo ○ Involve whole animal  In vitro ○ Defined populations of immune cells are studied under controlled.
Immunology ANTIBODIES we have ~10 12 antibodies made against foreign viruses, bacteria, parasites (vaccines) antibodies combine with foreign antigens to.
WHAT IS A WESTERN BLOT?.
Enzyme-Linked Immunosorbent Assay [ELISA] BCH 462[practical] Lab#5.
ELISA Assay. What Is It? Enzyme immunoassay (EIA) is a test used to detect and quantify specific antigen-eliciting molecules involved in biological processes,
Antibody Detection. Part II Detection of Antigens Western Blotting “Dot-Blot Assay” Positive Control Primary antibody (IgY) Lysed E. Coli Cells Lysed.
CHOIRUNIL CHOTIMAH INTRODUCTION Leishmaniasis Leishmania Parasites promastigotes amastigotes Difficult to treat Need effective vaccine.
Ex. 27: HIV ELISA, AIDS Diagnostic Tool. Human Immuno- deficiency Virus (HIV) First diagnosed in 1981 Over 20 million deaths worldwide, over a half million.
Antibodies Cells of the vertebrate acquired immune system produce antibodies with an exquisite specificity for molecules Biologists use antibodies to localize.
Western blotting. Antibodies in the Immune System Structure: 2 heavy chains + 2 light chains Disulfide bonds 2 antigen binding sites Isotypes: IgG, IgM,
Western Blot Lab. Western Blot reagents and equipment Mini Trans-Blot Apparatus : Passes electric current horizontally through gel – forcing negatively.
Immunodiagnostics.
 Antigen-antibody interactions Antigen Antibodies producedAntibodies binds antigen.
ELISA Nada Mohamed Ahmed , MD, MT (ASCP)i.
Human Immunodeficiency Virus (HIV) First diagnosed in 1981 Over 20 million deaths worldwide, over a half million in the United States Over 40 million currently.
Lecturer: David. * Reverse transcription PCR * Used to detect RNA levels * RNA is converted to cDNA by reverse transcriptase * Then it is amplified.
Western Blotting. Introduction … Western blotting, also known as immunoblotting or protein blotting, is a technique used to detect the presence of a specific.
IMMUNOLOGY.
Comparative Proteomics Kit II: Western Blot Analysis Module
Lab 24 Goals and Objectives: EDVOKIT#271: Simulation of HIV-1 Detection: ELISA Work in pairs: ten groups possible Perform as indicated (supplemental packet.
 Gel Electrophoresis  Gel staining  Transfer  Immunoblotting  Optimization.
Protein-protein interactions and western blotting MCB 130L Lecture 3.
Western blotting Pete Jones.
Enzyme Linked Immunosorbent Assay
Figure S1 A MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGL LSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKE EEKQTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQ.
Telephone    Provider of Global Contract Research Services Accelerating Preclinical Research, Drug Discovery.
WESTERN BLOT Reagents: 2x SDS buffer Running buffer Transfer buffer
Immunolocalization for EM Using immunoglobulin molecules as tags for select proteins and carbohydrates. Visualized by using colloidal gold or enzyme reactions.
GENE EXPRESSION STUDY ON PROTEIN LEVEL
Detection of Infectious diseases Using Antibodies
Lab# 5 Western Blot BCH 462[practical].
Immunoassays are tests that take advantage of the specificity of antibodies to their protein epitotes. Qualitative example: pregnancy test kits, HIV.
ELISA for mAb detection and Quantification
Comparative Proteomics Kit II: Western Blot Analysis Module
Enzyme-Linked Immunosorbent Assay ELISA
Blot, Blot, Western Baby Kristin B. Dupre June 30th, 2011.
Immunological Pregnancy Testing
Comparative Proteomics Kit II: Western Blot Module
The 14.6 kd rubber elongation factor (Hev b 1) and 24 kd (Hev b 3) rubber particle proteins are recognized by IgE from patients with spina bifida and.
Disruption of NDEL1 via knockdown of DISC1 stunts dendritic spine formation in hippocampal region of mice Amanda Atrash .5 s.
Disruption of NDEL1 via knockout of DISC1 stunts dendritic spine formation in hippocampal region of mice Amanda Atrash .5 s.
ELISA Immuno ExlorerTM HIV/AIDS Diagnostic Tool
Protein immuno-blotting, detection and analysis
Different applications of protein electrophorasis
Diagnostic tests for antibody or antigen
Human Pre-mRNA Cleavage Factor Im Is Related to Spliceosomal SR Proteins and Can Be Reconstituted In Vitro from Recombinant Subunits  Ursula Rüegsegger,
Lab# 5 Western Blot BCH 462[practical].
Western immunoblot of Acanthamoeba whole-cell lysates reacted with normal human serum, demonstrating immunoreactivity against Acanthamoeba antigens. Western.
Practical of Histopathology
Presentation transcript:

It's usually difficult to identify a protein of interest in a Commassie Blue-stained gel of cell extracts Coomassie Blue-stained gel MW stds. Cell extracts Size (kD) Western blots take advantage of the sensitivity of antibodies to visualize proteins of interest in complex preparations

How are epitope tags used to locate proteins on western blots? What steps are involved in western blots?

Proteins are expressed from plasmids that encode epitopes in the same reading frame with the cloned sequence Protein of interest Epitope added by plasmid sequences Antibody that binds the epitope Epitopes add antibody binding sites to proteins

9 AA ORF His 6 HA antibody binding domain of S. aureus protein A 14 AA ORF His 6 V5 pBG1805-encoded proteins have multiple epitopes, which add 19 kDa to the protein’s MW pYES2.1-encoded proteins have two epitopes, which add ~5 kDa to the protein’s MW

Epitope-tagged proteins on gel 1. Primary antibody binds proteins (stoichiometric) 2. Secondary antibodies recognize multiple sites on primary antibody 3. Enzyme or fluorochrome amplifies the signal Western blots typically use multiple antibodies to visualize epitope- tagged proteins

HRP Horseradish peroxidase (HRP) 40,000 MW enzyme Catalyzes reaction that produces a colored product Blue reaction product 3,3'5,5'-tetramethyl benzidine + H 2 O 2 HRP-catalyzed reaction amplifies the signal and generates a visible product

14 AA ORF His 6 V5 pYES2.1 9 AA ORF His 6 HA IgG binding domain pBG1805 Problem: How can proteins encoded by pBG1805 and pYES2.1 plasmids be visualized on the same gel? Sensitive (and expensive) monoclonal antibodies are available for the viral HA and V5 epitopes The His 6 tag is useful for purifying proteins, but it is a poor antigen

Staphylococcus aureus Protein A A solution: Use an alternative strategy to identify proteins encoded by pBG1805, based on the IgG binding domain of S. aureus protein A Protein A is a transmembrane protein with multiple binding sites for the F c portion of IgGs Helps bacterium to evade the host’s immune system during infections

Different strategies will be used to detect pBG1805- and pYES2.1- encoded proteins pYES2.1 -encoded proteins on gel Mouse monoclonal Ab detects V5 antigen HRP pBG1805-encoded proteins on gel HRP HRP-conjugated rabbit anti-mouse IgG polyclonal antibody

How are epitope tags used to locate proteins on western blots? What steps are involved in western blots?

A multi-layer "sandwich" of filter papers and sponges encloses the gel and the PVDF membrane within a transfer cassette

The cassette with its "sandwich" is inserted into the transfer apparatus Be mindful of the correct polarity! Black plate of sandwich toward black side of cassette holder The electric current transfers proteins from the gel to the membrane

SDS-PAGE gel PVDF membranes are hydrophobic. To bind proteins, they must first be wetted with methanol, followed by water and transfer buffer Proteins are electrophoretically transferred to a PVDF (essentially Teflon ) membrane

Blocking step PVDF membranes will bind proteins nonspecifically. Milk contains high concentrations of casein proteins, which bind and saturate these low affinity, nonspecific sites on the membranes. Epitope-tagged proteins (invisible) MW standards Membranes are incubated with 5% nonfat milk MW standards

Primary antibody binding step Primary antibody is a mouse monoclonal antibody that recognizes the V5 epitope – MW standards 2 – proteins with V5 epitope tag (pYES2.1) 3 – proteins with protein A domain (pBG1805) Antibodies bind with high affinity to V5 epitopes

1 – MW standards 2 – proteins with V5 epitope tag (pYES2.1) 3 – proteins with protein A domain (pBG1805) Secondary antibody is a rabbit polyclonal antibody that: recognizes the constant region of the mouse IgGs (lane 2) binds to S. aureus Protein A (lane 3) 1 2 3

1 – MW standards 2 – proteins with V5 epitope tag (pYES2.1) 3 – proteins with protein A domain (pBG1805) Detection Blot is incubated with substrates for HRP Blot is incubated until reaction products appear

Blue-black bands indicate the position of epitope-tagged proteins Western blot done by BC students

Process begins with the electrophoretic transfer of proteins to a membrane Blockin g Membrane replica Primary antibody Secondary antibody Enzymatic detectionFinal blot