Chapter 3 Computational Molecular Biology Michael Smith

Slides:



Advertisements
Similar presentations
Sequence Alignments with Indels Evolution produces insertions and deletions (indels) – In addition to substitutions Good example: MHHNALQRRTVWVNAY MHHALQRRTVWVNAY-
Advertisements

Global Sequence Alignment by Dynamic Programming.
Fa07CSE 182 CSE182-L4: Database filtering. Fa07CSE 182 Summary (through lecture 3) A2 is online We considered the basics of sequence alignment –Opt score.
Alignment methods Introduction to global and local sequence alignment methods Global : Needleman-Wunch Local : Smith-Waterman Database Search BLAST FASTA.
Sources Page & Holmes Vladimir Likic presentation: 20show.pdf
Lecture 8 Alignment of pairs of sequence Local and global alignment
Definitions Optimal alignment - one that exhibits the most correspondences. It is the alignment with the highest score. May or may not be biologically.
C E N T R F O R I N T E G R A T I V E B I O I N F O R M A T I C S V U E Alignments 1 Sequence Analysis.
Introduction to Bioinformatics Burkhard Morgenstern Institute of Microbiology and Genetics Department of Bioinformatics Goldschmidtstr. 1 Göttingen, March.
Sequence Similarity Searching Class 4 March 2010.
Heuristic alignment algorithms and cost matrices
Space Efficient Alignment Algorithms and Affine Gap Penalties
Sequencing and Sequence Alignment
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez June 23, 2005.
Alignment methods and database searching April 14, 2005 Quiz#1 today Learning objectives- Finish Dotter Program analysis. Understand how to use the program.
BNFO 240 Usman Roshan. Last time Traceback for alignment How to select the gap penalties? Benchmark alignments –Structural superimposition –BAliBASE.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez June 23, 2004.
Sequence similarity.
Dynamic Programming and Biological Sequence Comparison Part I.
Alignment methods June 26, 2007 Learning objectives- Understand how Global alignment program works. Understand how Local alignment program works.
Similar Sequence Similar Function Charles Yan Spring 2006.
Sequence Alignment II CIS 667 Spring Optimal Alignments So we know how to compute the similarity between two sequences  How do we construct an.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez May 20, 2003.
Sequence Alignment III CIS 667 February 10, 2004.
Introduction to Bioinformatics Algorithms Sequence Alignment.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Bioinformatics Workshop, Fall 2003 Algorithms in Bioinformatics Lawrence D’Antonio Ramapo College of New Jersey.
Sequence similarity. Motivation Same gene, or similar gene Suffix of A similar to prefix of B? Suffix of A similar to prefix of B..Z? Longest similar.
Dynamic Programming. Pairwise Alignment Needleman - Wunsch Global Alignment Smith - Waterman Local Alignment.
Developing Pairwise Sequence Alignment Algorithms Dr. Nancy Warter-Perez May 10, 2005.
Pairwise alignment Computational Genomics and Proteomics.
1 Sequences comparison 1 Issues Similarity gives a measure of how similar the sequences are. Alignment is a way to make clear the correspondence between.
Alignment methods II April 24, 2007 Learning objectives- 1) Understand how Global alignment program works using the longest common subsequence method.
Alignment Statistics and Substitution Matrices BMI/CS 576 Colin Dewey Fall 2010.
Developing Pairwise Sequence Alignment Algorithms
Pairwise alignments Introduction Introduction Why do alignments? Why do alignments? Definitions Definitions Scoring alignments Scoring alignments Alignment.
CISC667, S07, Lec5, Liao CISC 667 Intro to Bioinformatics (Spring 2007) Pairwise sequence alignment Needleman-Wunsch (global alignment)
Evolution and Scoring Rules Example Score = 5 x (# matches) + (-4) x (# mismatches) + + (-7) x (total length of all gaps) Example Score = 5 x (# matches)
Content of the previous class Introduction The evolutionary basis of sequence alignment The Modular Nature of proteins.
Sequence Alignment Goal: line up two or more sequences An alignment of two amino acid sequences: …. Seq1: HKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITN-EYMKEDFLIKIETWHKP.
Amino Acid Scoring Matrices Jason Davis. Overview Protein synthesis/evolution Protein synthesis/evolution Computational sequence alignment Computational.
Alignment methods April 26, 2011 Return Quiz 1 today Return homework #4 today. Next homework due Tues, May 3 Learning objectives- Understand the Smith-Waterman.
Pairwise Sequence Alignment. The most important class of bioinformatics tools – pairwise alignment of DNA and protein seqs. alignment 1alignment 2 Seq.
Pairwise Sequence Alignment BMI/CS 776 Mark Craven January 2002.
Pairwise alignment of DNA/protein sequences I519 Introduction to Bioinformatics, Fall 2012.
Sequence Analysis CSC 487/687 Introduction to computing for Bioinformatics.
Construction of Substitution Matrices
Sequence Alignment Csc 487/687 Computing for bioinformatics.
Function preserves sequences Christophe Roos - MediCel ltd Similarity is a tool in understanding the information in a sequence.
HMMs for alignments & Sequence pattern discovery I519 Introduction to Bioinformatics.
BLAST: Basic Local Alignment Search Tool Altschul et al. J. Mol Bio CS 466 Saurabh Sinha.
Multiple Sequence Alignment Colin Dewey BMI/CS 576 Fall 2015.
Biocomputation: Comparative Genomics Tanya Talkar Lolly Kruse Colleen O’Rourke.
Space Efficient Alignment Algorithms and Affine Gap Penalties Dr. Nancy Warter-Perez.
Pairwise sequence alignment Lecture 02. Overview  Sequence comparison lies at the heart of bioinformatics analysis.  It is the first step towards structural.
Sequence Alignment.
Lecture 15 Algorithm Analysis
Construction of Substitution matrices
Step 3: Tools Database Searching
Sequence comparison and database search.
More on HMMs and Multiple Sequence Alignment BMI/CS 776 Mark Craven March 2002.
9/6/07BCB 444/544 F07 ISU Dobbs - Lab 3 - BLAST1 BCB 444/544 Lab 3 BLAST Scoring Matrices & Alignment Statistics Sept6.
Sequence comparison: Local alignment
Biology 162 Computational Genetics Todd Vision Fall Aug 2004
Sequence Alignment 11/24/2018.
Pairwise Sequence Alignment
Lecture 14 Algorithm Analysis
BCB 444/544 Lecture 7 #7_Sept5 Global vs Local Alignment
Basic Local Alignment Search Tool (BLAST)
Presentation transcript:

Chapter 3 Computational Molecular Biology Michael Smith

Sequence Comparison Sequence comparison is the most important operation in computational biology Sequence comparison is the most important operation in computational biology Consists of finding which parts of the sequences are alike and which parts differ Consists of finding which parts of the sequences are alike and which parts differ

Similarity and Alignment Similarity Similarity  Gives a measure of how similar sequences are Alignment Alignment  A way of placing sequences one above the other in order to make clear the correspondence between similar characters or substrings

Sequence Comparison Want best alignment between two or more sequences Want best alignment between two or more sequences Global Comparison Global Comparison Alignment involving entire sequences Alignment involving entire sequences Local Comparison Local Comparison Alignment involving substrings Alignment involving substrings Semi-Global Comparison Semi-Global Comparison Aligning prefixes and suffixes of the sequences Aligning prefixes and suffixes of the sequences All can be solved by Dynamic Programming All can be solved by Dynamic Programming

Global Comparison Consider the following DNA sequences Consider the following DNA sequencesGACGGATTAGGATCGGAATAG  Are they similar?  After alignment, similarities are more obvious GA-CGGATTAGGATCGGAATAG

Alignment and Score Alignment, more precise definition Alignment, more precise definition Insertion of spaces in arbitrary locations along the sequences so that they end up with the same size Insertion of spaces in arbitrary locations along the sequences so that they end up with the same size No column can be entirely composed of spaces No column can be entirely composed of spaces Score Score Measure of similarity Measure of similarity Each column receive +1, for a match, -1 for a mismatch or -2 for a space Each column receive +1, for a match, -1 for a mismatch or -2 for a space Sum values to get score Sum values to get score

Dynamic Programming Solving an instance of a problem by taking advantage of already computed solutions for smaller instances of the problem Solving an instance of a problem by taking advantage of already computed solutions for smaller instances of the problem Main algorithmic approach used in sequence alignment Main algorithmic approach used in sequence alignment Figure 3.1, 3.2 Figure 3.1, 3.2

Optimal Alignments From Figure 3.1, start at (m,n) and follow arrows to (0,0) From Figure 3.1, start at (m,n) and follow arrows to (0,0) Each arrow gives one column of the alignment Each arrow gives one column of the alignment If arrow is horizontal, it corresponds to a column with a space in s matched with t[j] If arrow is horizontal, it corresponds to a column with a space in s matched with t[j] If arrow is vertical, it corresponds to s[i] matched with a space in t If arrow is vertical, it corresponds to s[i] matched with a space in t If arrow is diagonal, s[i] is matched with t[j] If arrow is diagonal, s[i] is matched with t[j]

Optimal Alignments Many alignments are possible, depending on which arrow is given priority Many alignments are possible, depending on which arrow is given priority

Local Comparison A local alignment between s and t is an alignment between a substring of s and a substring of t A local alignment between s and t is an alignment between a substring of s and a substring of t Goal : find the highest scoring local alignment between two sequences Goal : find the highest scoring local alignment between two sequences Variation of basic algorithm (Figure 3.2) Variation of basic algorithm (Figure 3.2) Each entry holds highest score of an alignment between suffixes of s and t (page 55) Each entry holds highest score of an alignment between suffixes of s and t (page 55)

SemiGlobal Comparison Score alignments ignoring some of the end spaces in the sequences Score alignments ignoring some of the end spaces in the sequences End spaces are those that appear before the first or after the last character in a sequence End spaces are those that appear before the first or after the last character in a sequence For example, For example,CAGCA-CTTGGATTCTCGG---CAGCGTGG If we aligned the sequences in the usual way, then If we aligned the sequences in the usual way, thenCAGCACTTGGATTCTCGGCAGC-----G-T----GG

Extensions to Basic Algorithm Basic algorithm has O(mn) complexity and uses space on the order of O(mn) Basic algorithm has O(mn) complexity and uses space on the order of O(mn) Possible to improve complexity from quadratic to linear at the expense of doubling processing time Possible to improve complexity from quadratic to linear at the expense of doubling processing time Can be accomplished by using a Divide and Conquer strategy Can be accomplished by using a Divide and Conquer strategy Divide the problem into small subproblems and later combine the solutions to obtain a solution for the whole problem Divide the problem into small subproblems and later combine the solutions to obtain a solution for the whole problem

Gap Penalty Functions A gap is a consecutive number of spaces A gap is a consecutive number of spaces When mutations occur, it is more likely to have a block of gaps verses a series of isolated gaps When mutations occur, it is more likely to have a block of gaps verses a series of isolated gaps Previous discussed scoring method is not appropriate in this case Previous discussed scoring method is not appropriate in this case

Gap Penalty Functions For example, For example,A------ATTCCTTCCTTCCAAAGAGAATTCCTTCCTTCC  Scoring is done at a block level, not a column level A ATTCCTTCCTTCC A AAGAGA ATTCCTTCCTTCC

Multiple Sequences Multiple sequence alignment is a generation of the two sequence case Multiple sequence alignment is a generation of the two sequence case Multiple alignment of s 1,s 2 …..s k is obtained by inserting spaces in the sequences in such a way to make them all the same size Multiple alignment of s 1,s 2 …..s k is obtained by inserting spaces in the sequences in such a way to make them all the same size No column is made entirely of spaces No column is made entirely of spaces Figure 3.10 Figure 3.10

Scoring Multiple Sequences Need a function that inputs amino acid sequences and returns a score Need a function that inputs amino acid sequences and returns a score The function must have two properties The function must have two properties Order of arguments must be independent. For example if a column has I,V,- the same score should be produced if the order is -,V,I Order of arguments must be independent. For example if a column has I,V,- the same score should be produced if the order is -,V,I Should reward the presence of many equal resides and penalize unequal residues and spaces Should reward the presence of many equal resides and penalize unequal residues and spaces

Sum-of-Pairs (SP) Sum-of-Pairs (SP) satisfies the properties Sum-of-Pairs (SP) satisfies the properties Sum of pairwise scores of all pairs of symbols in a column Sum of pairwise scores of all pairs of symbols in a column SP-score(I,-,I,V) = p(I,-) + p(I,I) + p(I,V) + SP-score(I,-,I,V) = p(I,-) + p(I,I) + p(I,V) + p(-,I) + p(-,V) + p(I,V) p(-,I) + p(-,V) + p(I,V) where p(a,b) is pairwise score of a and b

Algorithm Paradigm Dynamic programming is used again Dynamic programming is used again Basic algorithm can be used, but there will be problems Basic algorithm can be used, but there will be problems In two sequence case, complexity is O(n 2 ) In two sequence case, complexity is O(n 2 ) For k sequence case, complexity is O(n k ) For k sequence case, complexity is O(n k ) Can take a really long time if k is large Can take a really long time if k is large

Algorithm Paradigm Must reduce the amount or number of cells to compute Must reduce the amount or number of cells to compute Apply a heuristic to reduce the number of computed cells Apply a heuristic to reduce the number of computed cells

Star Alignments Building a multiple alignment based on pairwise alignments between a fixed sequence and all others Building a multiple alignment based on pairwise alignments between a fixed sequence and all others Fixed sequence is the center of the star Fixed sequence is the center of the star

Star Alignments Example Example a = ATTGCCATT b = ATGGCCATT c = ATCCAATTTT d = ATCTTCTT e = ACTGACC Select a as the center of the star

Star Alignments Align Align a with b a with c a with d a with e

Star Alignments ATTGCCATT ATTGCCATT ATGGCCATT ATGGCCATT ATTGCCATT-- ATTGCCATT-- ATC-CAATTTT ATC-CAATTTT ATTGCCATT ATTGCCATT ATCTTC-TT ATCTTC-TT ATTGCCATT ATTGCCATT ACTGACC-- ACTGACC--

Star Alignments Combine results Combine results ATTGCCATT-- ATTGCCATT-- ATGGCCATT-- ATGGCCATT-- ATC-CAATTTT ATC-CAATTTT ATCTTC-TT-- ATCTTC-TT-- ACTGACC---- ACTGACC----

Database Search Database exist for searching and comparing protein and DNA sequences Database exist for searching and comparing protein and DNA sequences Methods described work, but may take to long and be impractical for searching large databases Methods described work, but may take to long and be impractical for searching large databases Novel and faster methods have been developed Novel and faster methods have been developed

PAM Matrix When scoring protein sequences, the +1,-1,-2 may not be sufficient When scoring protein sequences, the +1,-1,-2 may not be sufficient Amino acids have properties that influence the likelihood that they will be substituted in an evolutionary scenario Amino acids have properties that influence the likelihood that they will be substituted in an evolutionary scenario

PAM Matrix Point Accepted Mutations Point Accepted Mutations A 1-PAM matrix is suitable for comparing sequences that are 1 unit of evolution apart A 1-PAM matrix is suitable for comparing sequences that are 1 unit of evolution apart A 250-PAM matrix is suitable for comparing sequences that are 250 units of evolution apart A 250-PAM matrix is suitable for comparing sequences that are 250 units of evolution apart

PAM Matrix Markovian in nature Markovian in nature Need the probability of for each amino acid Need the probability of for each amino acid Probability transition matrix Probability transition matrix Score matrix Score matrix

BLAST Most frequently programs used to search sequence databases Most frequently programs used to search sequence databases Acronym for Basic Alignment Search Tool Acronym for Basic Alignment Search Tool Returns a list of high scoring segment pairs between the query sequence and sequences in the database Returns a list of high scoring segment pairs between the query sequence and sequences in the database

FAST Another family of programs for sequence database search Another family of programs for sequence database search BLAST and FAST use PAM matrices BLAST and FAST use PAM matrices