1 Refined Solution Structure of HIV-1 Nef Stephen Grzesiek, Ad Bax, Jin-Shan Hu, Joshua Kaufman, Ira Palmer, Stephen J Stahl, Nico Tjandra and Paul T.

Slides:

Advertisements

Similar presentations

Protein NMR terminology COSY-Correlation spectroscopy Gives experimental details of interaction between hydrogens connected via a covalent bond NOESY-Nuclear.

Advertisements

At this point, we have used COSY and TOCSY to connect spin

Areas of Spectrum.

Continuum of Frequency Excite all Resonances at the same time F

1 Resonance assignment strategies. 2 Amino acid sequence + The assignment problem.

Structure Determination by NMR I. Choose a biologically important question. II. Determine if and how NMR can address the question. III. Synthesize or extract.

One-dimensional Spectra Provides 1. Chemical shifts & Relative Intensities 2. J-couplings.

Biomolecular Nuclear Magnetic Resonance Spectroscopy BASIC CONCEPTS OF NMR How does NMR work? Resonance assignment Structural parameters 02/03/10 Reading:

The NMR Fingerprints of Proteins: What you can see in simple spectra typical chemical shifts observed in proteins interpreting simple 1D spectra interpreting.

Structure Determination by NMR CHY 431 Biological Chemistry Karl D. Bishop, Ph.D. Lecture 1 - Introduction to NMR Lecture 2 - 2D NMR, resonance assignments.

Resonance assignment in proteins sequence of lysozyme: KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAA KFESNFNTQATNRNTDGSTDYGILQINSRWWCN DGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVS.

Assignment methods that use heteronuclear shift correlation for larger proteins (>10-15 kD), assignment methods based on 2D homonuclear 1 H- 1 H correlation.

A. S. Edison University of Florida 2006 Today’s Lecture 13) Mon, Oct 30: Assignments: I a. Important homonuclear (e.g. 1 H) experiments b. Small molecules.

Resonance Assignment for Proteins Classical homonuclear ( 1 H- 1 H) assignment methods: 1. Spin system assignments 2. Sequence-specific assignments 3.

Resonance Assignment NMR analysis of proteins Sequential resonance assignment strategies Practical Issues.

What is an assignment? Associate a given signal back to the originating spin.

Modeling of protein turns and derivation of NMR parameters related to turn structure Megan Chawner BRITE REU Program Advisor: Dr. Dimitrios Morikis Department.

Resonance assignments Part II: Approaches to sequence-specific assignments.

Automatic assignment of NMR spectral data from protein sequences using NeuroBayes Slavomira Stefkova, Michal Kreps and Rudolf A Roemer Department of Physics,

NMR Applications in Chemistry

Supplemental Information

Structure Determination by NMR CHY 431 Biological Chemistry Karl D. Bishop, Ph.D. One Dimensional NMR Two Dimensional NMR Resonance Assignment Procedures.

Nuclear Magnetic Resonance in Structural Biology Part I the physical principle the physical principle the spectrometer the spectrometer the NMR spectrum.

How to Analyze of 2D NMR Spectra ( small molecules) 노 정 래.

Intro to NMR for CHEM 645 we also visited the website: The Basics of NMR by Joseph P. Hornak, Ph.D. The Basics of NMR.

Protein Structure: NMR Spectroscopy Microbiology 343 David Wishart

1 Biomolecular NMR Spectroscopy Methods and applications to proteins Robert Kaptein Novosibirsk, November 2012.

Biomolecular Nuclear Magnetic Resonance Spectroscopy BASIC CONCEPTS OF NMR How does NMR work? Resonance assignment Structure determination 01/24/05 NMR.

1 Introduction to Biomolecular NMR. 2 Nuclear Magnetic Resonance Spectroscopy Certain isotopes ( 1 H, 13 C, 15 N, 31 P ) have intrinsic magnetic moment.

-1/2 E +1/2 low energy spin state

Automating Steps in Protein Structure Determination by NMR CS April 13, 2009.

Biomolecular Nuclear Magnetic Resonance Spectroscopy FROM ASSIGNMENT TO STRUCTURE Sequential resonance assignment strategies NMR data for structure determination.

National Magnetic Resonance Facility At Madison NMRFAM

The number of protons yielding correlations in a 2D NOESY spectrum quickly overwhelms the space available on A 2D map. 15N labeling can help simplify the.

Biomolecular Nuclear Magnetic Resonance Spectroscopy BASIC CONCEPTS OF NMR How does NMR work? Resonance assignment Structural parameters 01/28/08 Reading:

Protein NMR Part II.

JG/10-09 NMR for structural biology DNA purification Protein domain from a database Protein structure possible since 1980s, due to 2-dimensional (and 3D.

Biomolecular Nuclear Magnetic Resonance Spectroscopy BASIC CONCEPTS OF NMR How does NMR work? Pulse FT NMR 2D NMR experiments nD NMR experiments 01/15/03.

1/60 An Iterative Relaxation Technique for the NMR Backbone Assignment Problem Wen-Lian Hsu Institute of Information Science Academia Sinica.

1/62 An Iterative Relaxation Technique for the NMR Backbone Assignment Problem Wen-Lian Hsu Institute of Information Science Academia Sinica.

Solution Structure Determination by NMR and Distance Geometry Calculations 1. Pure Protein (0.3 mL, mM; ~ 10 mg) 2. Sequence-specific resonance.

Assignment Strategies -N-C  -CO-N-C  -CO- H H-C-H H O-C-O HH H-C-H O-H -N-C  -CO-N-C  -CO- H H-C-H H O-C-O HH H-C-H O-H Homonuclear  Two steps needed.

3D Triple-Resonance Methods for Sequential Resonance Assignment of Proteins Strategy: Correlate Chemical Shifts of Sequentially Related Amides to the Same.

The Pulse FT NMR Experiment equilibration 90º pulse detection of signals Experiment (t) Data Analysis Fourier Transform Time domain (t)

Fast Course in NMR Lecture 7

How NMR is Used for the Study of Biomacromolecules Analytical biochemistry Comparative analysis Interactions between biomolecules Structure determination.

RDCs NMR of Biological Macromolecules in Solution More resonances; shorter T2/broader lines Similar basic techniques- HSQC, TOCSY, NOESY Other experiments.

These 2D methods work for proteins up to about 100 amino acids, and even here, anything from amino acids is difficult. We need to reduce the complexity.

Areas of Spectrum. Remember - we are thinking of each amino acid as a spin system - isolated (in terms of 1 H- 1 H J-coupling) from the adjacent amino.

Protein NMR Spectroscopy Institute of Biomedical Sciences

Calcium-Induced Conformational Switching of Paramecium Calmodulin Provides Evidence for Domain Coupling Jaren et al. Biochemistry 2002, 41,

Volume 3, Issue 1, Pages (January 1995)

Douglas Kojetin, Ph.D. UC College of Medicine

NMR Spectroscopy – Part 2

1. Pure Protein (0.3 mL, mM; ~ 10 mg)

Application of NMR in Structural Proteomics

Volume 24, Issue 7, Pages (July 2016)

NMR Spectroscopy Question and Answer Session

Solid-State NMR Characterization of Gas Vesicle Structure

Structure determination by NMR

Volume 12, Issue 9, Pages (September 2005)

Structure determination by NMR

Structure Determination by NMR

CHY 431 Biological Chemistry

Structure of Bax Motoshi Suzuki, Richard J. Youle, Nico Tjandra Cell

Chapter 16. 3D Experiments.

Proteins Have Too Many Signals!

Volume 4, Issue 2, Pages (February 1996)

Volume 109, Issue 7, Pages (October 2015)

Presentation transcript:

1 Refined Solution Structure of HIV-1 Nef Stephen Grzesiek, Ad Bax, Jin-Shan Hu, Joshua Kaufman, Ira Palmer, Stephen J Stahl, Nico Tjandra and Paul T. Wingfield. Protein Science (1997), 6:

2  Length : 206 amino acid  Importance: expressed at high level in the early stages of HIV infection and key protein in viral replication.  Residues 2-39 ( N-terminus ) are unstructured so these residues were deleted.  Three deletion mutant (i) NEF δ2-39, (ii ) NEF δ2-39, δ and (iii) NEF δ2-39, δ in complex with the SH3 domain of tyrosine protein Kinase were studied. About the protein:

3 Flow Chart for 3D structure determination using NMR

4 Assignment methods that use heteronuclear shift correlation  For larger proteins (>10-15 kD), assignment methods based on 2D homonuclear 1H-1H correlation methods (COSY/TOCSY/NOESY) don’t work very well because of overlapping resonances and broad linewidths.  An alternative (which is now used even for small proteins in most cases) is to use heteronuclear shift correlation experiments on 13C, 15N labelled samples.  In these experiments, magnetization is transferred from 1H to 13C and/or 15N through large one-bond scalar couplings.

5 Hetero-nuclear multi-dimensional NMR experiments for resonance assignment

6 Some Triple Resonance experiments

7 Frequencies Observed with correlation

8 Assignment Strategy for HIV-1 NEF:  Identify a cross peak in HNCO spectra.  For corresponding 1 H and 15 N identify CA and CB resonance in HNCA and HNCACB. ( intraresidue connections)  HA and HB can be identified from NOESY and HOHAHA.  Using CBCA(CO)NH and HBHA(CO)NH inter-residue connections can be established.  Repeating the procedure with all HNCO peaks can lead to long fragments of protein sequence.  This fragments can be assigned to probable amino acid type using characteristic CA and CB frequencies.

9

10 Assignment strategy : An example

11 Structural information:  Not much from chemical shift so….  Inter-proton distances from NOESY.  J-coupling experiments.

12 NOE informations

13 Assigned HSQC shows random coil region Random coil region corresponding to Residue

14 Structural information from T2 relaxation and NOE relaxation data

15 Final Structure and Statistics

16