Bioinformatics Jack Min Office 3012 Office hours: TR 12:15 – 4.

Slides:



Advertisements
Similar presentations
Pairwise sequence alignment.
Advertisements

NCBI/WHO PubMed/Hinari Course NCBI Literature Databases: PubMed Background.
Beyond PubMed and BLAST: Exploring NCBI tools and databases Kate Bronstad David Flynn Alumni Medical Library.
Bunu databases’in icine koy lecture 5i de sonuna
NCBI data, sliding window programs and dot plots Sept. 25, 2012 Learning objectives-Become familiar with OMIM and PubMed. Understand the difference between.
Creating NCBI The late Senator Claude Pepper recognized the importance of computerized information processing methods for the conduct of biomedical research.
Genome databases and webtools for genome analysis Become familiar with microbial genome databases Use some of the tools useful for analyzing genome Visit.
Biology 4900 Biocomputing. Chapter 2 Molecular Databases and Data Analysis.
On line (DNA and amino acid) Sequence Information Lecture 7.
Bioinformatics Tutorial I BLAST and Sequence Alignment.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 2: “Homology” Searches and Sequence Alignments.
Bioinformatics for biomedicine Summary and conclusions. Further analysis of a favorite gene Lecture 8, Per Kraulis
Introduction to Bioinformatics Lecturer: Dr. Yael Mandel-Gutfreund Teaching Assistant: Shula Shazman Sivan Bercovici Course web site :
Archives and Information Retrieval
Sequence Analysis MUPGRET June workshops. Today What can you do with the sequence? What can you do with the ESTs? The case of SNP and Indel.
Introduction to Bioinformatics Spring 2008 Yana Kortsarts, Computer Science Department Bob Morris, Biology Department.
Bioinformatics and Phylogenetic Analysis
Lecture 2.21 Retrieving Information: Using Entrez.
Biological Databases Notes adapted from lecture notes of Dr. Larry Hunter at the University of Colorado.
Genome Related Biological Databases. Content DNA Sequence databases Protein databases Gene prediction Accession numbers NCBI website Ensembl website.
Biological Databases Chi-Cheng Lin, Ph.D. Associate Professor Department of Computer Science Winona State University – Rochester Center
Bioinformatics Student host Chris Johnston Speaker Dr Kate McCain.
Sequence Analysis. Today How to retrieve a DNA sequence? How to search for other related DNA sequences? How to search for its protein sequence? How to.
Bioinformatics Unit 1: Data Bases and Alignments Lecture 3: “Homology” Searches and Sequence Alignments (cont.) The Mechanics of Alignments.
Signaling Pathways and Summary June 30, 2005 Signaling lecture Course summary Tomorrow Next Week Friday, 7/8/05 Morning presentation of writing assignments.
A Study of Cystic Fibrosis Using Web-Based Tools Anuradha Datta Murphy Graduate Student, Dept. of Molecular and Integrative Physiology, University of Illinois.
Accessing journals by via PubMed Note the link to find articles through HINARI/PubMed. Using this option will be covered in later in the Short Course.
On line (DNA and amino acid) Sequence Information
Bioinformatics.
Pairwise Alignments Part 1 Biology 224 Instructor: Tom Peavy Sept 8
An Introduction to Bioinformatics
Genomics, Proteomics, and Bioinformatics Biology 224 Instructor: Tom Peavy January 29, 2008.
Sequence Databases What are they and why do we need them.
Introduction to Bioinformatics Part 1 of 2 Jonathan Pevsner, Ph.D. M.E: September 8, 2003.
NCBI’s Bioinformatics Resources Michele R. Tennant, Ph.D., M.L.I.S. Health Science Center Libraries U.F. Genetics Institute January 2015.
Introduction to Bioinformatics CPSC 265. Interface of biology and computer science Analysis of proteins, genes and genomes using computer algorithms and.
Genomics, Proteomics, and Bioinformatics Biology 224 Instructor: Tom Peavy August 31, 2009.
Introduction to Bioinformatics Monday, November 15, 2010 Jonathan Pevsner Bioinformatics M.E:
Searching PubMed® NCBI, NLM Resources, Micromedex -GSBS TTUHSC Preston Smith Library presents Rev. 08/17/14.
UCSC Genome Browser 1. The Progress 2 Database and Tool Explosion : 230 databases and tools 1996 : first annual compilation of databases and tools.
BIOINFORMATICS IN BIOCHEMISTRY Bioinformatics– a field at the interface of molecular biology, computer science, and mathematics Bioinformatics focuses.
Introduction to Bioinformatics Introduction to Databases
Introduction to Bioinformatics Databases. DNARNAphenotypeprotein Central dogma of molecular biology A main focus of bioinformatics is to study molecular.
Organizing information in the post-genomic era The rise of bioinformatics.
REMINDERS 2 nd Exam on Nov.17 Coverage: Central Dogma of DNA Replication Transcription Translation Cell structure and function Recombinant DNA technology.
Accessing information on molecular sequences Bio 224 Dr. Tom Peavy Sept 1, 2010.
NCBI Literature Databases: PubMed
EB3233 Bioinformatics Introduction to Bioinformatics.
COT 6930 HPC and Bioinformatics Sequence Alignment Xingquan Zhu Dept. of Computer Science and Engineering.
Bioinformatics and Computational Biology
341- INTRODUCTION TO BIOINFORMATICS Overview of the Course Material 1.
Copyright OpenHelix. No use or reproduction without express written consent1.
PubMed …featuring more than 20 million citations for biomedical literature from MEDLINE, life science journals, and online books.
Copyright OpenHelix. No use or reproduction without express written consent1.
An Introduction to NCBI & BLAST National Center for Biotechnology Information Richard Johnston Pasadena City College.
Tools in Bioinformatics Genome Browsers. Retrieving genomic information Previous lesson(s): annotation-based perspective of search/data Today: genomic-based.
Information retrieval and sliding window programs April 5, 2011 Hand in Homework #1. Homework #2 due Tuesday, April 12. Learning objectives- Understand.
Genome Bioinformatics DNA and protein Databases I.
Instructor Prof. Chandrama P. Upadhyaya 220, Life Sciences Building ,
What is sequencing? Video: WlxM (Illumina video) WlxM.
生物資料庫搜尋 ( 第八組 ) 連威森 王鼎 黃智楹 張鈞淵
Keeping Current: Genetics Resources. This workshop will provide an overview of NCBI resources for finding-- Background information & journal articles.
Chapter 2: Access to Information Jonathan Pevsner, Ph.D.
Introduction to Bioinformatics
Introduction to Bioinformatics and Functional Genomics
Archives and Information Retrieval
What is Bioinformatics?
Mangaldai College, Mangaldai
Access to Sequence Data and Related Information
PubMed.
Presentation transcript:

Bioinformatics Jack Min Office 3012 Office hours: TR 12:15 – 4

How would you define "bioinformatics"? Can you distinguish between a gene and a genome? Do you know what a Blast search is? Do you know what any of the letters in "blast" represent? What is Genbank? What is NCBI? What is meant by "codon usage"?

Here are two nucleotide sequences: (i) AGTCGGTAACCTAAG (ii) GGCAAAUACUAAGGA Which of these is a DNA sequence? Explain your answer. Here is a DNA sequence: 5' ATTGGRTCCAATA 3‘ (i) What do the 5' and 3' mean? (ii) What does the R stand for? (iii) Write the sequence of the complementary DNA strand, using the same notation.

What is meant by the "template" and "coding" strands of DNA? Name three different kinds of RNA. Which amino acids are represented by the following symbols?A L Q K G W

International Union of Pure and Applied Chemistry

What is a PAM matrix? Can both nucleotide and amino acid sequences be used to build molecular phylogenies? Explain the method of parsimony for building sequence-based phylogenies. What is the program CLUSTAL used for? What do you know about microarrays? For instance, are there different types of microarrays, and what are they used for?

This question is to test your general knowledge of genetics and molecular biology. Can you define the following terms? (a) Gene (b)Locus (c) Allele (d) Linkage (e) Linkage disequilibrium (f) synonymous substitution (g) Intron (h) concerted evolution (i) Pleiotropy (j) PCR (k) RFLP (l) Haplotype

To provide an introduction to bioinformatics with a focus on the National Center for Biotechnology Information (NCBI) and EBI To focus on the analysis of DNA, RNA and proteins To introduce you to the analysis of genomes To combine theory and practice to help you solve research problems What are the goals of the course?

Themes throughout the course Textbooks Web sites Literature references Gene/protein families Computer labs

Textbook Bioinformatics and Functional Genomics Second edition (Wiley, 2009). Reference Bioinformatics Third edition (Wiley, 2005) Baxevanis and Ouellette

Web sites The course website is reached via moodle: (or Google “moodle bioinformatics”) --This site contains the powerpoints for each lecture. including color and black & white versions --The weekly quizzes are here The textbook website is: This has powerpoints, URLs, etc. organized by chapter

Literature references You are encouraged to read original source articles (posted on moodle). They will enhance your understanding of the material. Readings are optional but recommended.

Themes throughout the course: gene/protein families We will use beta globin and retinol-binding protein 4 (RBP4) as model genes/proteins throughout the course. Globins including hemoglobin and myoglobin carry oxygen. RBP4 is a member of the lipocalin family. It is a small, abundant carrier protein. We will study globins and lipocalins in a variety of contexts including --sequence alignment --gene expression --protein structure --phylogeny --homologs in various species

Computer labs You can use any computer you can find – Computer lab in the department, in your lab, Computers in my lab (3013)

Outline for today Definition of bioinformatics Overview of the NCBI website Accessing information about DNA and proteins --Definition of an accession number --Four ways to find information on proteins and DNA Access to biomedical literature Pairwise alignment: introduction

What is Bioinformatics? Broad definition: The use of computational tools for: acquiring, storing and analyzing biological information. Narrow definition: The use of computational tools for: acquiring, storing and analyzing molecular sequence information.

Interface of biology and computers Analysis of proteins, genes and genomes using computer algorithms and computer databases Genomics is the analysis of genomes. The tools of bioinformatics are used to make sense of the billions of base pairs of DNA that are sequenced by genomics projects. What is bioinformatics?

Tool-users Tool-makers bioinformatics public health informatics medical informatics infrastructure databases algorithms

Three perspectives on bioinformatics The cell The organism The tree of life Page 4

DNARNAphenotypeprotein Page 5

Time of development Body region, physiology, pharmacology, pathology Page 5

After Pace NR (1997) Science 276:734 Page 6

Fig. 2.1 Page 17

Growth of GenBank + Whole Genome Shotgun (1982-November 2008) Number of sequences in GenBank (millions) Base pairs of DNA in GenBank (billions) Base pairs in GenBank + WGS (billions)

DNARNAprotein Central dogma of molecular biology genometranscriptomeproteome Central dogma of bioinformatics and genomics

DNARNA cDNA ESTs UniGene phenotype genomic DNA databases protein sequence databases protein Fig. 2.2 Page 20

GenBankEMBLDDBJ There are three major public DNA databases The underlying raw DNA sequences are identical Page 16

GenBankEMBLDDBJ Housed at EBI European Bioinformatics Institute There are three major public DNA databases Housed at NCBI National Center for Biotechnology Information Housed in Japan Page 16

The Trace Archive at NCBI contains over 2 billion traces 11/08

Taxonomy at NCBI: ~200,000 species are represented in GenBank

The most sequenced organisms in GenBank Homo sapiens 13.1 billion bases Mus musculus 8.4b Rattus norvegicus 6.1b Bos taurus5.2b Zea mays 4.6b Sus scrofa (wild boar)3.6b Danio rerio (zebrafish) 3.0b Oryza sativa (japonica) 1.5b Strongylocentrotus purpurata (sea urchins)1.4b Nicotiana tabacum 1.1b Updated GenBank release Excluding WGS, organelles, metagenomics Table 2-2 Page 18

National Center for Biotechnology Information (NCBI) Page 24

Fig. 2.5 Page 25

Fig. 2.5 Page 25

PubMed is… National Library of Medicine's search service 16 million citations in MEDLINE links to participating online journals PubMed tutorial (via “Education” on side bar) Page 24

Entrez integrates… the scientific literature; DNA and protein sequence databases; 3D protein structure data; population study data sets; assemblies of complete genomes Page 24

Entrez is a search and retrieval system that integrates NCBI databases Page 24

BLAST is… Basic Local Alignment Search Tool NCBI's sequence similarity search tool supports analysis of DNA and protein databases 100,000 searches per day Page 25

OMIM is… Online Mendelian Inheritance in Man catalog of human genes and genetic disorders created by Dr. Victor McKusick; led by Dr. Ada Hamosh at JHMI Page 25

Books is… searchable resource of on-line books Page 26

TaxBrowser is… browser for the major divisions of living organisms (archaea, bacteria, eukaryota, viruses) taxonomy information such as genetic codes molecular data on extinct organisms Page 26

Structure site includes… Molecular Modelling Database (MMDB) biopolymer structures obtained from the Protein Data Bank (PDB) Cn3D (a 3D-structure viewer) vector alignment search tool (VAST) Page 26

Outline for today Definition of bioinformatics Overview of the NCBI website Accessing information about DNA and proteins --Definition of an accession number --Five ways to find information on proteins and DNA Access to biomedical literature Pairwise alignment: introduction

Accession numbers are labels for sequences NCBI includes databases (such as GenBank) that contain information on DNA, RNA, or protein sequences. You may want to acquire information beginning with a query such as the name of a protein of interest, or the raw nucleotides comprising a DNA sequence of interest. DNA sequences and other molecular data are tagged with accession numbers that are used to identify a sequence or other record relevant to molecular data. Page 26

What is an accession number? An accession number is label that used to identify a sequence. It is a string of letters and/or numbers that corresponds to a molecular sequence. Examples (all for retinol-binding protein, RBP4): X02775GenBank genomic DNA sequence NT_030059Genomic contig Rs dbSNP (single nucleotide polymorphism) N An expressed sequence tag (1 of 170) NM_006744RefSeq DNA sequence (from a transcript) NP_007635RefSeq protein AAC02945GenBank protein Q28369SwissProt protein 1KT7Protein Data Bank structure record protein DNA RNA Page 27

Five ways to access DNA and protein sequences [1] Entrez Gene with RefSeq [2] UniGene [3] European Bioinformatics Institute (EBI) and Ensembl (separate from NCBI) [4] ExPASy Sequence Retrieval System (separate from NCBI) [5] UCSC Genome Browser Page 27

5 ways to access protein and DNA sequences [1] Entrez Gene with RefSeq Entrez Gene is a great starting point: it collects key information on each gene/protein from major databases. It covers all major organisms. RefSeq provides a curated, optimal accession number for each DNA (NM_006744) or protein (NP_007635) Page 27

From the NCBI home page, type “beta globin” and hit “Go” revised 11/08 Fig. 2.7 Page 29

revised Fig. 2.7 Page 29

By applying limits, there are now fewer entries

revised Fig. 2.8 Page 30 Entrez Gene (top of page) Note that links to many other HBB database entries are available

Entrez Gene (middle of page)

Entrez Gene (middle of page, continued)

Entrez Gene (bottom of page): RefSeqs

Entrez Gene (bottom of page): non-RefSeq accessions

Fig. 2.9 Page 32

Fig. 2.9 Page 32

Fig. 2.9 Page 32

FASTA format: versatile, compact with >one header line followed by a string of nucleotides or amino acids in the single letter code Fig Page 32

Five ways to access DNA and protein sequences [1] Entrez Gene with RefSeq [2] UniGene [3] European Bioinformatics Institute (EBI) and Ensembl (separate from NCBI) [4] ExPASy Sequence Retrieval System (separate from NCBI) [5] UCSC Genome Browser Page 31

DNARNA complementary DNA (cDNA) protein UniGene Fig. 2.3 Page 23

UniGene: unique genes via ESTs Find UniGene at NCBI: UniGene clusters contain many expressed sequence tags (ESTs), which are DNA sequences (typically 500 base pairs in length) corresponding to the mRNA from an expressed gene. ESTs are sequenced from a complementary DNA (cDNA) library. UniGene data come from many cDNA libraries. Thus, when you look up a gene in UniGene you get information on its abundance and its regional distribution. Pages 20-21

Cluster sizes in UniGene This is a gene with 1 EST associated; the cluster size is 1 Fig. 2.3 Page 23

Cluster sizes in UniGene This is a gene with 10 ESTs associated; the cluster size is 10

Cluster sizes in UniGene (human) Cluster size (ESTs) Number of clusters 1  40, , , , , ,200  ,900   ,00074  16,000-65,0008 UniGene build 216, 11/ :70000[ESTC]

UniGene: unique genes via ESTs Conclusion: UniGene is a useful tool to look up information about expressed genes. UniGene displays information about the abundance of a transcript (expressed gene), as well as its regional distribution of expression (e.g. brain vs. liver). We will discuss UniGene further in gene expression section. Page 31

Five ways to access DNA and protein sequences [1] Entrez Gene with RefSeq [2] UniGene [3] European Bioinformatics Institute (EBI) and Ensembl (separate from NCBI) [4] ExPASy Sequence Retrieval System (separate from NCBI) [5] UCSC Genome Browser Page 31

Ensembl to access protein and DNA sequences Try Ensembl at for a premier human genome web browser. We will encounter Ensembl as we study the human genome, BLAST, and other topics.

click human

enter RBP4

Five ways to access DNA and protein sequences [1] Entrez Gene with RefSeq [2] UniGene [3] European Bioinformatics Institute (EBI) and Ensembl (separate from NCBI) [4] ExPASy Sequence Retrieval System (separate from NCBI) [5] UCSC Genome Browser Page 33

ExPASy to access protein and DNA sequences ExPASy sequence retrieval system (ExPASy = Expert Protein Analysis System) Visit Page 33

Fig Page 33

Five ways to access DNA and protein sequences [1] Entrez Gene with RefSeq [2] UniGene [3] European Bioinformatics Institute (EBI) and Ensembl (separate from NCBI) [4] ExPASy Sequence Retrieval System (separate from NCBI) [5] UCSC Genome Browser Page 33

[1] Visit click Genome Browser [2] Choose organisms, enter query (beta globin), hit submit

Example of how to access sequence data: HIV-1 pol There are many possible approaches. Begin at the main page of NCBI, and type an Entrez query: hiv-1 pol Page 34

11/08

Page 34 Searching for HIV-1 pol: Following the “genome” link yields a manageable five results

Example of how to access sequence data: HIV-1 pol For the Entrez query: hiv-1 pol there are about 80,000 nucleotide or protein records (and >200,000 records for a search for “hiv-1”), but these can easily be reduced in two easy steps: --specify the organism, e.g. hiv-1[organism] --limit the output to RefSeq! Page 34

only 1 RefSeq over 200,000 nucleotide entries for HIV-1

Examples of how to access sequence data: histone query for “histone”# results protein records21847 RefSeq entries7544 RefSeq (limit to human)1108 NOT deacetylase697 At this point, select a reasonable candidate (e.g. histone 2, H4) and follow its link to Entrez Gene. There, you can confirm you have the right gene/protein

Outline for today Definition of bioinformatics Overview of the NCBI website Accessing information about DNA and proteins --Definition of an accession number --Four ways to find information on proteins and DNA Access to biomedical literature Pairwise alignment: introduction

PubMed at NCBI to find literature information

PubMed is the NCBI gateway to MEDLINE. MEDLINE contains bibliographic citations and author abstracts from over 4,600 journals published in the United States and in 70 foreign countries. It has >18 million records dating back to 1950s. Page 35 Updated 11-08

MeSH is the acronym for "Medical Subject Headings." MeSH is the list of the vocabulary terms used for subject analysis of biomedical literature at NLM. MeSH vocabulary is used for indexing journal articles for MEDLINE. The MeSH controlled vocabulary imposes uniformity and consistency to the indexing of biomedical literature. Page 35

lipocalin AND disease (60 results) lipocalin OR disease (1,650,000 results) lipocalin NOT disease (530 results) 1 AND 2 1 OR 2 1 NOT Fig Page 34

true positive “globin” is found “globin” is not found “globin” is present “globin” is absent Article contents: Search result: true negative false negative ( article discusses globins ) false positive ( article does not discuss globins )

Pairwise sequence alignment

Outline: pairwise alignment Overview and examples Definitions: homologs, paralogs, orthologs Assigning scores to aligned amino acids: Dayhoff’s PAM matrices Alignment algorithms: Needleman-Wunsch, Smith-Waterman Statistical significance of pairwise alignments

It is used to decide if two proteins (or genes) are related structurally or functionally It is used to identify domains or motifs that are shared between proteins It is the basis of BLAST searching It is used in the analysis of genomes Pairwise sequence alignment is the most fundamental operation of bioinformatics

Pairwise alignment: protein sequences can be more informative than DNA protein is more informative (20 vs 4 characters); many amino acids share related biophysical properties codons are degenerate: changes in the third position often do not alter the amino acid that is specified protein sequences offer a longer “look-back” time DNA sequences can be translated into protein, and then used in pairwise alignments

Page 54

DNA can be translated into six potential proteins 5’ CAT CAA 5’ ATC AAC 5’ TCA ACT 5’ GTG GGT 5’ TGG GTA 5’ GGG TAG Pairwise alignment: protein sequences can be more informative than DNA 5’ CATCAACTACAACTCCAAAGACACCCTTACACATCAACAAACCTACCCAC 3’ 3’ GTAGTTGATGTTGAGGTTTCTGTGGGAATGTGTAGTTGTTTGGATGGGTG 5’

Pairwise alignment: protein sequences can be more informative than DNA Many times, DNA alignments are appropriate --to confirm the identity of a cDNA --to study noncoding regions of DNA --to study DNA polymorphisms --example: Neanderthal vs modern human DNA Query: 181 catcaactacaactccaaagacacccttacacccactaggatatcaacaaacctacccac 240 |||||||| |||| |||||| ||||| | ||||||||||||||||||||||||||||||| Sbjct: 189 catcaactgcaaccccaaagccacccct-cacccactaggatatcaacaaacctacccac 247

Pairwise alignment The process of lining up two sequences to achieve maximal levels of identity (and conservation, in the case of amino acid sequences) for the purpose of assessing the degree of similarity and the possibility of homology. Definitions

Homology Similarity attributed to descent from a common ancestor. Definitions Page 42

Homology Similarity attributed to descent from a common ancestor. Definitions Identity The extent to which two (nucleotide or amino acid) sequences are invariant. Page 44 RBP: 26 RVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVA 59 + K GTW++MA + L + A glycodelin: 23 QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKA 55

Orthologs Homologous sequences in different species that arose from a common ancestral gene during speciation; may or may not be responsible for a similar function. Paralogs Homologous sequences within a single species that arose by gene duplication. Definitions: two types of homology Page 43

Orthologs: members of a gene (protein) family in various organisms. This tree shows RBP orthologs. common carp zebrafish rainbow trout teleost African clawed frog chicken mouse rat rabbitcowpig horse human 10 changes Page 43

Paralogs: members of a gene (protein) family within a species apolipoprotein D retinol-binding protein 4 Complement component 8 prostaglandin D2 synthase neutrophil gelatinase- associated lipocalin 10 changes Lipocalin 1 Odorant-binding protein 2A progestagen- associated endometrial protein Alpha-1 Microglobulin /bikunin Page 44

1 MKWVWALLLLAAWAAAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEG 50 RBP. ||| |. |... | :.||||.:| : 1...MKCLLLALALTCGAQALIVT..QTMKGLDIQKVAGTWYSLAMAASD. 44 lactoglobulin 51 LFLQDNIVAEFSVDETGQMSATAKGRVR.LLNNWD..VCADMVGTFTDTE 97 RBP : | | | | :: |.|. || |: || |. 45 ISLLDAQSAPLRV.YVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTK 93 lactoglobulin 98 DPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV QYSC 136 RBP || ||. | :.|||| |..| 94 IPAVFKIDALNENKVL VLDTDYKKYLLFCMENSAEPEQSLAC 135 lactoglobulin 137 RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQ.EELCLARQYRLIV 185 RBP. | | | : ||. | || | 136 QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI lactoglobulin Pairwise alignment of retinol-binding protein 4 and  -lactoglobulin Page 46

Similarity The extent to which nucleotide or protein sequences are related. It is based upon identity plus conservation. Identity The extent to which two sequences are invariant. Conservation Changes at a specific position of an amino acid or (less commonly, DNA) sequence that preserve the physico- chemical properties of the original residue. Definitions

1 MKWVWALLLLAAWAAAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEG 50 RBP. ||| |. |... | :.||||.:| : 1...MKCLLLALALTCGAQALIVT..QTMKGLDIQKVAGTWYSLAMAASD. 44 lactoglobulin 51 LFLQDNIVAEFSVDETGQMSATAKGRVR.LLNNWD..VCADMVGTFTDTE 97 RBP : | | | | :: |.|. || |: || |. 45 ISLLDAQSAPLRV.YVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTK 93 lactoglobulin 98 DPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV QYSC 136 RBP || ||. | :.|||| |..| 94 IPAVFKIDALNENKVL VLDTDYKKYLLFCMENSAEPEQSLAC 135 lactoglobulin 137 RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQ.EELCLARQYRLIV 185 RBP. | | | : ||. | || | 136 QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI lactoglobulin Pairwise alignment of retinol-binding protein and  -lactoglobulin Identity (bar) Page 46

1 MKWVWALLLLAAWAAAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEG 50 RBP. ||| |. |... | :.||||.:| : 1...MKCLLLALALTCGAQALIVT..QTMKGLDIQKVAGTWYSLAMAASD. 44 lactoglobulin 51 LFLQDNIVAEFSVDETGQMSATAKGRVR.LLNNWD..VCADMVGTFTDTE 97 RBP : | | | | :: |.|. || |: || |. 45 ISLLDAQSAPLRV.YVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTK 93 lactoglobulin 98 DPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV QYSC 136 RBP || ||. | :.|||| |..| 94 IPAVFKIDALNENKVL VLDTDYKKYLLFCMENSAEPEQSLAC 135 lactoglobulin 137 RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQ.EELCLARQYRLIV 185 RBP. | | | : ||. | || | 136 QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI lactoglobulin Pairwise alignment of retinol-binding protein and  -lactoglobulin Somewhat similar (one dot) Very similar (two dots) Page 46

1 MKWVWALLLLAAWAAAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEG 50 RBP. ||| |. |... | :.||||.:| : 1...MKCLLLALALTCGAQALIVT..QTMKGLDIQKVAGTWYSLAMAASD. 44 lactoglobulin 51 LFLQDNIVAEFSVDETGQMSATAKGRVR.LLNNWD..VCADMVGTFTDTE 97 RBP : | | | | :: |.|. || |: || |. 45 ISLLDAQSAPLRV.YVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTK 93 lactoglobulin 98 DPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAV QYSC 136 RBP || ||. | :.|||| |..| 94 IPAVFKIDALNENKVL VLDTDYKKYLLFCMENSAEPEQSLAC 135 lactoglobulin 137 RLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQ.EELCLARQYRLIV 185 RBP. | | | : ||. | || | 136 QCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI lactoglobulin Pairwise alignment of retinol-binding protein and  -lactoglobulin Internal gap Terminal gap Page 46

Positions at which a letter is paired with a null are called gaps. Gap scores are typically negative. Since a single mutational event may cause the insertion or deletion of more than one residue, the presence of a gap is ascribed more significance than the length of the gap. In BLAST, it is rarely necessary to change gap values from the default. Gaps