ANPER - anthocyanin permease AOMT - anthocyanin O-methyltransferase CHI - chalcone isomerase DFR - dihydroflavonol 4-reductase F3H - flavonoid 3' hydroxylase.

Slides:

Advertisements

Similar presentations

The Arabidopsis Information Resource (TAIR)

Advertisements

Genomes and Proteomes genome: complete set of genetic information in organism gene sequence contains recipe for making proteins (genotype) proteome: complete.

Submitting a Genome to RAST. Uploading Your Job 1.Login to your RAST account. You will need to register if this is your first time using SEED technologies.

EST Search for Genes in the Cold Tolerance Pathway of Vaccinium corymbosum Shamita Punjabi.

What is RefSeqGene?.

2 Unité de Biométrie et d’Intelligence Artificielle (UBIA) INRA

EAnnot: A genome annotation tool using experimental evidence Aniko Sabo & Li Ding Genome Sequencing Center Washington University, St. Louis.

Scarlet Runner Bean Genome Annotation: Contig

© Wiley Publishing All Rights Reserved. Using Nucleotide Sequence Databases.

Cloning genes involved in the flavonoid pathway of pink and white Hydrangea macrophylla Melissa DellaTorre, Bowdoin College Danial Hasani, mentor, NFU.

AHM 2002 Tutorial on Scientific Data Mediation Example 1.

Annotating a Scarlet Runner Bean genome fragment put together by shotgun sequencing Scarlet Runner ean Max Bachour.

PH Regulation in Blueberries Locating Nhx1. Which proteins regulate pH? The Nhe or Nhx (Na/H exchanger) family of genes – Six known members of this family.

The design, construction and use of software tools to generate, store, annotate, access and analyse data and information relating to Molecular Biology.

PROMoter SCanning/ANalysis tool. Goal Creating a tool to analyse a set of putative promoter sequences and recognize known and unknown promoters, with.

Alignment of mRNAs to genomic DNA Sequence Martin Berglund Khanh Huy Bui Md. Asaduzzaman Jean-Luc Leblond.

Practice retrieving data and running stand alone BLAST. Step 1. Identify genes in the ABA biosynthesis pathway from the Arabidopsis Cyc database

How to access genomic information using Ensembl August 2005.

Bioinformatics Alternative splicing Multiple isoforms Exonic Splicing Enhancers (ESE) and Silencers (ESS) SpliceNest Lecture 13.

Sequence Analysis. Today How to retrieve a DNA sequence? How to search for other related DNA sequences? How to search for its protein sequence? How to.

Cytochrome P450 Monooxygenases

BIOLOGY 3020 Fall 2008 Gene Hunting (DNA database searching)

Arabidopsis Gene Project GK-12 April Workshop Karolyn Giang and Dr. Mulligan.

Bikash Shakya Emma Lang Jorge Diaz.  BLASTx entire sequence against 9 plant genomes. RepeatMasker  55.47% repetitive sequences  82.5% retroelements.

Genome Annotation and Databases Genomic DNA sequence Genomic annotation BIO520 BioinformaticsJim Lund Reading Ch 9, Ch10.

Arabidopsis Genome Annotation TAIR7 Release. Arabidopsis Genome Annotation  Overview of releases  Current release (TAIR7)  Where to find TAIR7 release.

NCBI Review Concepts Chuong Huynh. NCBI Pairwise Sequence Alignments Purpose: identification of sequences with significant similarity to (a)

Discover the UniProt Blast tool. Murcia, February, 2011Protein Sequence Databases Customize the BLAST results.

What Makes the “Blue” in Blueberries? -The Truth about Myb Dylan Coughtrey Laboratory Methods in Genomics Spring 2011.

Functional Annotation of Proteins via the CAFA Challenge Lee Tien Duncan Renfrow-Symon Shilpa Nadimpalli Mengfei Cao COMP150PBT | Fall 2010.

Browsing the Genome Using Genome Browsers to Visualize and Mine Data.

Team Conoscenza Bioinformatics Tan Jian Wei ~ Tan Fengnan.

Introduction The genus Gossypium (Cotton) is believed to have originated between five to fifteen million years ago. Evidence indicates that 2 genome groups,

Web Databases for Drosophila Introduction to FlyBase and Ensembl Database Wilson Leung6/06.

Genome Annotation Rosana O. Babu.

Sackler Medical School

Biological databases Exercises. Discovery of distinct sequence databases using ensembl.

Fig. 1 Generalized pathway leading to anthocyanidin 3-glucosides (Holton and Cornish 1995). Anthocyanins of non-blue flowers (rose, chrysanthemum and carnation)

Curation Tools Gary Williams Sanger Institute. SAB 2008 Gene curation – prediction software Gene prediction software is good, but not perfect. Out of.

Web Databases for Drosophila An introduction to web tools, databases and NCBI BLAST Wilson Leung08/2015.

+ Nhx1 Aligning Orthologs and Identifying Alleles Alexis Valauri-Orton and Puneet Lakhmani.

Floral Timing Mike Nuttle.

Laura McCoy.  rRNA genes are a multi-gene family  Located in the nucleolus of the cell  Genes are found in tandem arrays  rRNA plus ribosomal proteins.

Cool BaRC Web Tools Prat Thiru. BaRC Web Tools We have.

Bioinformatics Workshops 1 & 2 1. use of public database/search sites - range of data and access methods - interpretation of search results - understanding.

UCSC Genome Browser Zeevik Melamed & Dror Hollander Gil Ast Lab Sackler Medical School.

Annotation of eukaryotic genomes

What is BLAST? Basic BLAST search What is BLAST?

Welcome to the combined BLAST and Genome Browser Tutorial.

Cold Tolerance in Vaccinium corymbosum Shamita Punjabi Lab Methods in Genomics BIO 343 Davidson College.

NCBI: something old, something new. What is NCBI? Create automated systems for knowledge about molecular biology, biochemistry, and genetics. Perform.

Gene_identifier color_no gtm1_mouse 2 gtm2_mouse 2 >fasta_format_description_line >GTM1_HUMAN GLUTATHIONE S-TRANSFERASE MU 1 (GSTM1-1) PMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI.

Work Presentation Novel RNA genes in A. thaliana Gaurav Moghe Oct, 2008-Nov, 2008.

Myb Transcription Factors Dylan Coughtrey Laboratory Methods in Genomics Spring 2011.

The Bovine Genome Database Abstract The Bovine Genome Database (BGD, facilitates the integration of bovine genomic data. BGD is.

BLAST: Basic Local Alignment Search Tool Robert (R.J.) Sperazza BLAST is a software used to analyze genetic information It can identify existing genes.

Web Databases for Drosophila

What is BLAST? Basic BLAST search What is BLAST?

Introduction to Genes and Genomes with Ensembl

Fig. 1. Simplified overview of flavonol and anthocyanin biosynthesis within the phenylpropanoid pathway and its regulation in grape by characterized MYB.

Basics of BLAST Basic BLAST Search - What is BLAST?

Sequence based searches:

GEP Annotation Workflow

Gene Annotation with DNA Subway

Zhu Hui-Fen , Fitzsimmons Karen , Khandelwal Abha , Kranz Robert G.

Ensembl Genome Repository.

2 Unité de Biométrie et d’Intelligence Artificielle (UBIA) INRA

Flavonoid analyses of petal extracts.

Introduction to Alternative Splicing and my research report

Fig. 2 Biosynthetic pathways of anthocyanins and related flavonoids

Presentation transcript:

ANPER - anthocyanin permease AOMT - anthocyanin O-methyltransferase CHI - chalcone isomerase DFR - dihydroflavonol 4-reductase F3H - flavonoid 3' hydroxylase LDOX - leucoanthocyanidin dioxygenase FLS- flavonol synthase Myba1 - myb-related transcription factor MycA1 - myc anthocyanin regulatory protein UFGT - UDP-glucose:flavonoid 3-O-glucosyltransferase Allan Browns Wish List: EST Results

ANPER - anthocyanin permease Allan Browns Wish List: EST Results Towson Database

ANPER - anthocyanin permease gb|AY | Lycopersicon esculentum putative anthocyanin permease mRNA, complete cds BLAST match Allan Browns Wish List: EST Results Towson Database BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

ANPER - anthocyanin permease Allan Browns Wish List: EST Results WSU Database

ANPER - anthocyanin permease PREDICTED: Vitis vinifera protein TRANSPARENT TESTA 12-like (LOC ), BLAST match Allan Browns Wish List: EST Results WSU Database BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

AOMT - anthocyanin O-methyltransferase Allan Browns Wish List: EST Results WSU Database

AOMT - anthocyanin O-methyltransferase Rhododendron catawbiense early light-induced protein 7 mRNA, BLAST match Allan Browns Wish List: EST Results WSU Database BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

CHI - chalcone isomerase Allan Browns Wish List: EST Results

CHI - chalcone isomerase component of oligomeric golgi complex 6 BLAST match Liriodendron tulipifera clone BAC125P15 FLORICAULA/LEAFY-like protein, glycyl-tRNA synthetase-like protein, and VARIANT IN METHYLATION-like protein genes, complete cds; and integral membrane protein gene, partial cds Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

DFR - dihydroflavonol 4-reductase Allan Browns Wish List: EST Results

DFR - dihydroflavonol 4-reductase BLAST match Vaccinium macrocarpon dihydroflavonol 4-reductase mRNA Vitis vinifera dihydroflavonol-4- reductase-like (LOC ) Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

F3H - flavonoid 3' hydroxylase Allan Browns Wish List: EST Results

LDOX - leucoanthocyanidin dioxygenase Allan Browns Wish List: EST Results

LDOX - leucoanthocyanidin dioxygenase BLAST match Vaccinium corymbosum anthocyanidin synthase (ans) mRNA Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

FLS- flavonol synthase Allan Browns Wish List: EST Results

FLS- flavonol synthase BLAST match Antirrhinum hispanicum slf- S5 gene for S locus F-box (SLF)-S5 protein and slf-S5A gene for S locus F-box (SLF)-S5A protein Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

Myba1 - myb-related transcription factor Allan Browns Wish List: EST Results

Myba1 - myb-related transcription factor Rubus idaeus Myb-related transcription factor gene Populus trichocarpa predicted protein (MYB084) Vaccinium myrtillus MYB1-like mRNA Malus x domestica MYB24 mRNA, complete cds Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST

MycA1 - myc anthocyanin regulatory protein Allan Browns Wish List: EST Results

UFGT - UDP-glucose:flavonoid 3-O-glucosyltransferase Allan Browns Wish List: EST Results

UFGT - UDP-glucose:flavonoid 3-O-glucosyltransferase BLAST match Actinidia chinensis flavonoid 3-0- galactosyltransferase mRNA Allan Browns Wish List: EST Results BLAST verified BLAST invalid EST

ANPER - anthocyanin permease AOMT - anthocyanin O-methyltransferase CHI - chalcone isomerase DFR - dihydroflavonol 4-reductase F3H - flavonoid 3' hydroxylase LDOX - leucoanthocyanidin dioxygenase FLS- flavonol synthase Myba1 - myb-related transcription factor MycA1 - myc anthocyanin regulatory protein UFGT - UDP-glucose:flavonoid 3-O-glucosyltransferase BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting Allan Browns Wish List: EST Results

ANPER – short, 3 end of scaffold AOMT – tBLASTn carboxyl end protein, 3 end scaffold CHI – big chunk of scaffold near SSR site DFR – grape cDNA F3H - big chunk of scaffold near SSR site LDOX – medium chunk from scaffold FLS - big chunk of scaffold Myba1 – tBLASTn with peptide sequence MycA1 - big chunk of scaffold UFGT - tBLASTn with peptide sequence Best Methods – avoid big scaffold chunks BLAST verified BLAST invalid EST BLAST surprise, wrong but interesting

1) BLAST grape (other plant) cDNA or protein sequence 2) collect scaffold hits (threshold E value < 0.001) 3) automatically BLAST scaffold against ESTs 4) Return full EST sequences and sources 5) From results: Allow all ESTs to be BLASTed against NCBI to ID All ESTs to be BLASTed against blueberry genome What tool do we need to improve system?

1) Query ESTs and genome annotations with EC numbers 2) Web site that ranks SSR results: (user inputs) 3) Align ESTs or cDNAs with scaffolds to find introns 4) Tool for collecting all allele or paralog scaffolds 5) Visualize aligned sequences from #4 6) Visualize KEGG pathway map with personal results 7) Compare blueberry and grape annotations What tool do we need to improve system?