1. From Pairwise Alignment to Database Similarity Search

2. Outline Summary Local and Global alignments FASTA and BLAST algorithms Evaluating significance of alignments

3. Best score for aligning part of sequences Dynamic programming Algorithm: Smith-Waterman Table cells never score below zero Best score for aligning the full length sequences Dynamic programming Algorithm: Needelman- Wunch Table cells are allowed any score Global Local Pairwise Alignment Summary

4. Available tools for Sequence Alignments ALIGNALIGN -- GLOBAL (N-W)/ LOCAL (S-W) BLAST2SEQBLAST2SEQ – Only LOCAL using word match spideyspidey -- aligns mRNAs to genomic sequence est2genomeest2genome -- aligns ESTs to genomic sequence

5. Gap Scores >Human DNA CATGCGACTGACcgacgtcgatcgatacgactagctagcATCGATCATA >Human mRNA CATGCGACTGACATCGATCATA Biologically, indels occur in groups we want our gap score to reflect this

6. Gap Scores Standard solution: affine gap model –Once-off cost for opening a gap –Lower cost for extending the gap –Changes required to algorithm

7. Affine Gap Penalty w x = g + r(x-1) w x : total gap penalty; g: gap open penalty; r: gap extend penalty;x: gap length gap penalty chosen –Gaps not excluded –Gaps not over included –Typical Values: g=-12; r = -4

8. Is this good enough ???

9. Drawbacks to DP Approaches Compute intensive Memory Intensive

10. Complexity Complexity is determined by size of table –Aligning a sequence of length m against one of length n requires calculating (m  n) cells Estimate: we calculate 10 8 cells per second –Aligning two mRNA sequences of 8,000 bp requires 64,000,000 cells –Aligning an mRNA and a 10 7 bp chromosome requires ~10 11 cells

11. Searching databases Goal: Find homologue sequences in database to query input.

12. new sequence ? Sequence Database similar function ≈ Similar function

13. Searching databases Goal: Find homologue sequences in database to query input. Naïve solution: Use exact algorithm to compare each sequence in the database to query.

15. Complexity for genomes Human genome contains 3  10 9 base pairs –Searching an mRNA against HG requires ~10 13 cells -Even efficient exact algorithms will be extremely slow when preformed millions of times. -Running the computations in parallel is expensive.

16. So what can we do?

17. Searching databases Solutions: 1.Use a heuristic (approximate) algorithm to discard most irrelevant sequences. 2.Perform the exact algorithm on the small group of remaining sequences.

18. Heuristic strategy Homologous sequences are expected to contain common short segments (probably with substitutions, but without ins/dels) Preprocess database (DB) into new data structure to enable fast accession Remove low-complexity regions that are not useful for meaningful alignments

19. AAAAAAAAAAA ATATATATATATA Transposable elements (LINEs, SINEs) Low Complexity Sequences

20. Whats wrong with them? produce artificial high scoring alignments. So what do we do?: We apply Low Complexity masking to the query sequence Mask TCGATCGTATATATACGGGGGGTA TCGATCGNNNNNNNNCNNNNNNTA

21. Low Complexity Sequences Complexity is calculated as: Where N=4 in DNA (4 bases), L is the length of the sequence And n i the number of each residue in the sequence K=1/L log N (L!/Π n i !) all i For the sequence GGGG: L! =4x3x2x1=24 n g =4 n c =0 n a =0 n t =0 Πn i =24x1x1x1=24 K =1/4 log 4 (24/24)=0 For the sequence CTGA: L! =4x3x2x1=24 ng =1 nc =1 na =1 nt =1 Πni =1x1x1x1 K =1/4 log 4 (24/1)=0.573

22. Heuristic (approximate solution) Methods: FASTA and BLAST FASTA (Lipman & Pearson 1985) –First fast sequence searching algorithm for comparing a query sequence against a database BLAST - Basic Local Alignment Search Technique (Altschul et al 1990) –improvement of FASTA: Search speed, ease of use, statistical rigor –Gapped BLAST (Altschul et al 1997)

23. FASTA and BLAST Common idea - a good alignment contains subsequences of absolute identity: –First, identify very short (almost) exact matches. –Next, the best short hits from the 1st step are extended to longer regions of similarity. –Finally, the best hits are optimized using the Smith- Waterman algorithm.

24. FastA (fast alignment) Assumption: a good alignment probably matches some identical ‘words’ Example: Aligning a query sequence to a database Database record: ACTTGTAGATACAAAATGTG Query sequence: A-TTGTCG-TACAA-ATCTG Matching words of size 4

25. Preprocess of all the sequences in the database. Find short words and organize in dictionaries. Process the query sequence and prepare a dictionary. –ATGGCTGCTCAAGT…. ATGGTGGCGGCT… … FastA Query

26. FastA locates regions of the query sequence and the search set sequence that have high densities of exact word matches. For DNA sequences the word length used is 6. seq1 seq2

27. The 10 highest-scoring sequence regions are saved and re-scored using a scoring matrix. seq1 seq2

28. FastA determines if any of the initial regions from different diagonals may be joined together to form an approximate alignment with gaps. Only non-overlapping regions may be joined. seq1 seq2

29. The score for the joined regions is the sum of the scores of the initial regions minus a joining penalty for each gap. seq1 seq2

30. FastA final stage Apply an exact algorithm of local alignment on surviving records, computing the final alignment score. Calculate an Alignment score (S) Evaluate the statistical significance

31. Assessing Alignment Significance Determine probability of alignment occurring at random Ideal No Good Random Related

32. FastA at EMBL

33. FastA A set of programs for database searching. FastA EMBLEMBL

34. FASTA SEQUENCE FORMAT This format contains a one line header followed by lines of sequence data. Sequences in fasta formatted files are preceded by a line starting with a" >" symbol. The first word on this line is the name of the sequence. The remaining lines contain the sequence itself. Blank lines in a FASTA file are ignored,

35. FastA at EMBL Output, general information: –Z’ score = deviation (in sd) of the actual score from the mean of random scores Z=(x-mean)/sd –Opt: the number of optimized scores observed. Lower limit –E( ): the number of sequences expected in the score range.

36. FastA at EMBL

38. BLAST Basic Local Alignment Search Tool Developed to be as sensitive as FastA but much faster. Also searches for short words. –Protein 3 letter words –DNA 11 letter words. –Words can be similar, not only identical

39. Word Search -BLAST Identity - CAT : CAT Similarity – CAT : CAT, CAY, HAT … But even CAT : XTX can be similar For each three letter word there are many similar words (depending on the alphabet). Similar words are only the ones that have a minimum cut-off score (T). Y= C or T H= A, C, T X=A or T or C or G

40. BLAST Find matching word pairs Extend word pairs as much as possible, i.e., as long as the total weight increases Result: High-scoring Segment Pairs (HSPs) THEFIRSTLINIHAVEADREAMESIRPATRICKREAD INVIEIAMDEADMEATTNAMHEWASNINETEEN

41. BLAST Try to connect HSPs by aligning the sequences in between them: THEFIRSTLINIHAVEADREA____M_ESIRPATRICKREAD INVIEIAMDEADMEATTNAMHEW___ASNINETEEN The Gapped Blast algorithm allows several segments that are separated by short gaps to be connected together to one alignment

42. Score and E-value The score is a measure of the similarity of the query to the sequence shown. The E-value is a measure of the reliability of the score. E-value is the probability due to chance, that there is another alignment with a similarity greater than the given S score.

43. Bit score (S) : –Similar to alignment score –Normalized –Higher means more significant Score (S):  (identities + mismatches)-  gaps BLAST- Score

44. BLAST- E value: Expected # of alignments with score at least S Increases linearly with length of query sequence Increases linearly with length of database Decreases exponentially with score of alignment –K,λ: statistical parameters dependent upon scoring system and background residue frequencies m = length of query ; n= length of database ; s= score

45. What is a Good E-value - thumb rules E values of less than 0.00001 show that sequences are almost always homologues. Greater E values, can represent homologues as well. Generally the decision whether an E-value is biologically significant depends on the size of database that is searched

46. Significance of Gapped Alignments Gapped alignments use same statistics and K cannot be easily estimated Empirical estimations and gap scores determined by looking at random alignments

47. BLAST Blast is a family of programs: BlastN, BlastP, BlastX, tBlastN, tBlastX BlastN - nt versus nt database BlastP - protein versus protein database BlastX - translated nt versus protein database tBlastN - protein versus translated nt database tBlastX - translated nt versus translated nt database Query:DNAProtein Database:DNAProtein

48. BLAST at NCBI Output –Graphical out put of top results –The alignments for top scores –Scores for each alignment: 1.E value 2.Bits score: a score normalized with respect to the scoring system. Can be used to compare different searches.