1. Regular Languages and Regular Grammars Chapter 3

2. Regular Languages Regular Language Regular Expression Finite State Machine Accepts Describes

3. Operators on Regular Expressions ()Parentheses * Star Closure Concatenation + Union. Example: Over  = {a, b, c}, (a + (b. c)) * produces: {λ, a, bc, aa, abc, bcbc, … } In order of precedence: Note: The concatenation symbol is often omitted.

4. Regular Expressions Let  be a given alphabet. Then 1. , λ, and a   are all primitive regular expressions. 2. If r 1 and r 2 are regular expressions, so are r 1 + r 2, r 1. r 2, r 1 *, and (r 1 ) 3.A string is a regular expression, iff it can be derived from the primitive regular expressions by a finite number of application of the rules in (2).

5. Languages Associated with Regular Expressions If r is a regular expression L(r) is a language associated with r. Rules to simplify languages associated with r: L(  ) =  L( λ) = λ L(a) = {a} L(r 1 + r 2 ) = L(r 1 ) U L(r 2 ) L(r 1. r 2 ) = L(r 1 ). L(r 2 ) L((r 1 )) = L(r 1 ) L(r 1 * ) = (L(r 1 )) *

6. Analyzing a Regular Expression L(( a + b )* b ) = L(( a + b )*) L( b ) = (L( a + b ))* L( b ) = (L( a ) U L( b ))* L( b ) = ({ a } U { b })* { b } = { a, b }* { b }. A string of a’s and b’s that end with b

7. L( a * b *)= L( a *)L( b *) = {a}*{b}* A string of zero or more a’s followed by a string of zero or more b’s. Analyzing a Regular Expression

8. L = {w  { a, b }* : w = |w| is even} ((a + b)(a + b))* or (aa + ab + ba + bb)* Given a Language, find a rex

9. Examples L = {w  { a, b }* : w contains an odd number of a’s} b*(ab*ab*)*ab* or b*ab*(ab*ab*)* Both expressions require that there be a single a somewhere. There can also be other a’s, but they must occur in pairs.

10. More Regular Expression Examples Try these: L = {w  { a, b }*: there is no more than one b in w} L(r) = {a 2n b 2m+1 : n  0, m  0}

11. More Regular Expression Examples Try these: L = {w  { a, b }*: there is no more than one b in w} a*(λ+b)a* or a* + a*ba* L(r) = {a 2n b 2m+1 : n  0, m  0} (aa)*(bb)*b

12. The Details Matter a * + b *  ( a + b )* ( ab )*  a * b *

13. Rex to NFA Finite state machines and regular expressions define the same class of languages. Theorem: Any language that can be defined with a regular expression can be accepted by some NFA and so is regular. Proof by Construction: Must show that an NFA can be constructed using rules for: , λ, any symbol in , union, and concatenation.

14. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  :

15. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  :

16. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  : A single element of  :

17. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  : A single element of  :

18. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  : A single element of  : λ :

19. For Every Regular Expression There is a Corresponding FSM We’ll show this by construction. An FSM for:  : A single element of  : λ :

20. FSA that recognizes s + t ;;; … … M 1 (recognizes string s) M 2 (recognizes string t) λ λ λ λ Union

21. ;;; … … λ λ λ FSA that recognizes st Concatenation M 1 (recognizes string s)M 2 (recognizes string t)

22. Star Closure ;;; … λ λ M 1 (recognizes string s) λ λ FSA that recognizes s * λ

23. An Example (b + ab )* An FSM for a An FSM for b An FSM for ab : λ

24. An Example ( b + ab )* An FSM for ( b + ab ): λ λ λ

25. An Example An FSM for ( b + ab )*: λ λ λ λ λ λ λ λ

26. An Example A Simplified FSM for ( b + ab )*: a b b λ λ

27. For Every FSM There is a Corresponding Regular Expression Theorem: Every regular language (i.e., every language that can be accepted by some DFSM) can be defined with a regular expression. Proof by Construction: Use generalized transition graphs (GTGs) to convert FSM to REX. A GTG is a transition graph whose edges are labeled with regular expressions.

28. A Simple Example Let M be: Suppose we rip out state 2:

29. The Algorithm fsmtoregexheuristic fsmtoregexheuristic(M: FSM) = 1. Remove unreachable states from M. 2. If M has no accepting states then return . 3. If the start state of M is part of a loop, create a new start state s and connect s to M’s start state via an λ -transition. 4. If there is more than one accepting state of M or there are any transitions out of any of them, create a new accepting state and connect each of M’s accepting states to it via an λ -transition. The old accepting states no longer accept. 5. If M has only one state then return λ. 6. Until only the start state and the accepting state remain do: 6.1 Select rip (not s or an accepting state). 6.2 Remove rip from M. 6.3 *Modify the transitions among the remaining states so M accepts the same strings. 7. Return the regular expression that labels the one remaining transition from the start state to the accepting state.

30. Example 1 1.Create a new initial state and a new, unique accepting state, neither of which is part of a loop. Note:   λ

31. 2. Remove states and arcs and replace with arcs labeled with larger and larger regular expressions. Example 1, Continued

32. Remove state 3: Example 1, Continued

33. Remove state 2: + Example 1, Continued

34. Remove state 1: + ++

35. Example 2 a * (a + b)c *

36. Example 3 a * + a * (a + b)c *

37. Simplifying Regular Expressions Regex’s describe sets: ● Union is commutative:  +  =  + . ● Union is associative: (  +  ) +  =  + (  +  ). ●  is the identity for union:  +  =  +  = . ● Union is idempotent:  +  = . Concatenation: ● Concatenation is associative: (  )  =  (  ). ● λ is the identity for concatenation:  λ = λ  = . ●  is a zero for concatenation:   =   = . Concatenation distributes over union: ● (  +  )  = (   ) + (   ). ●  (  +  ) = (   ) + (   ). Kleene star: ●  * = λ. ● λ * = λ. ●(  *)* =  *. ●  *  * =  *. ●(  +  )* = (  *  *)*.

38. Applications of regular expressions: Pattern Matching Many applications allow pattern matches unix perl Excel Access … Pattern matching programs use automata pattern  rex  nfa  dfa  transition table  driver

39. A Biology Example – BLAST Given a protein or DNA sequence, find others that are likely to be evolutionarily close to it. ESGHDTTTYYNKNRYPAGWNNHHDQMFFWV Build a DFSM that can examine thousands of other sequences and find those that match any of the selected patterns.

40. Regular Expressions in Perl SyntaxNameDescription abcConcatenationMatches a, then b, then c, where a, b, and c are any regexs a | b | cUnion (Or)Matches a or b or c, where a, b, and c are any regexs a*a*Kleene starMatches 0 or more a’s, where a is any regex a+a+At least oneMatches 1 or more a’s, where a is any regex a?a?Matches 0 or 1 a’s, where a is any regex a{n, m}ReplicationMatches at least n but no more than m a’s, where a is any regex a*?ParsimoniousTurns off greedy matching so the shortest match is selected a+?  .Wild cardMatches any character except newline ^Left anchorAnchors the match to the beginning of a line or string $Right anchorAnchors the match to the end of a line or string [a-z][a-z] Assuming a collating sequence, matches any single character in range [^ a - z ] Assuming a collating sequence, matches any single character not in range \d\d Digit Matches any single digit, i.e., string in [ 0 - 9 ] \D\D Nondigit Matches any single nondigit character, i.e., [^ 0 - 9 ] \w\w Alphanumeric Matches any single “word” character, i.e., [ a - zA - Z0 - 9 ] \W\W Nonalphanumeric Matches any character in [^ a - zA - Z0 - 9 ] \s\s White spaceMatches any character in [space, tab, newline, etc.]

41. SyntaxNameDescription \S\S Nonwhite space Matches any character not matched by \ s \n\n NewlineMatches newline \r\r ReturnMatches return \t\t TabMatches tab \f\f FormfeedMatches formfeed \b\b BackspaceMatches backspace inside [] \b\b Word boundaryMatches a word boundary outside [] \B\B Nonword boundaryMatches a non-word boundary \0\0 NullMatches a null character \ nnn OctalMatches an ASCII character with octal value nnn \ x nn HexadecimalMatches an ASCII character with hexadecimal value nn \cX\cX ControlMatches an ASCII control character \ char QuoteMatches char ; used to quote symbols such as. and \ (a)(a)StoreMatches a, where a is any regex, and stores the matched string in the next variable \1VariableMatches whatever the first parenthesized expression matched \2Matches whatever the second parenthesized expression matched …For all remaining variables Regular Expressions in Perl

42. Using Regular Expressions in the Real World Matching numbers: -? ([0-9]+(\.[0-9]*)? | \.[0-9]+) Matching ip addresses: S! ([0-9]{1,3} (\. [0-9] {1,3}){3}) ! $1 ! Finding doubled words: \ From Friedl, J., Mastering Regular Expressions, O’Reilly,1997.

43. More Regular Expressions Identifying spam: \badv\(?ert\)?\b Trawl for email addresses: \b[A-Za-z0-9_%-]+@[A-Za-z0-9_%-]+ (\.[A-Za- z]+){1,4}\b

44. Using Substitution Building a chatbot: On input: is the chatbot will reply: Why is ?

45. Chatbot Example The food there is awful Why is the food there awful? Assume that the input text is stored in the variable $text : $text =~ s/^([A-Za-z]+)\sis\s([A-Za-z]+)\.?$/ Why is \1 \2?/ ;

46. Regular Grammars A regular grammar G is a quadruple (V, T, S, P) that is either consistently right-linear or consistently left-linear. ● V - Variables ● T – Terminals ● S - Start variable, S  V ● P - Productions

47. Right-Linear Grammar All production rules are of the form: A  xBorA  x A,B  VA and B are variables x  T * x is a string in the alphabet Example: G = ({S}, {a, b}, S, P) P: S  abS | a Corresponding Regular Expression: (ab) * a

48. Left-Linear Grammar All production rules are of the form: A  BxorA  x A,B  VA and B are variables x  T * x is a string in the alphabet Example: G = ({S, S 1, S 2 }, {a, b}, S, P) P: S  S 1 ab S 1  S 1 ab | S 2 S 2  a Corresponding Regular Expression: aab(ab) *

49. Focus on Right-Linear Grammars A language generated by a right-linear grammar is always regular. Proof by construction of FA on page 91 of text. Example: Construct an FA that accepts the language generated by the grammar: V 0  aV 1 V 1  abV 0 | b

50. Focus on Right-Linear Grammars V 0  aV 1 V 1  b V 1  abV 0 Complete FA:

51. Right-Linear Grammars Every regular language can be generated by some right-linear grammar. Proof by reverse construction of an FA, page 93 of text. Example: Find a right-linear grammar that generates the language accepted by the FA shown below.

52. G = {{Q 0, Q 1, Q 2 }, {0, 1}, Q 0, P} P:Q 0  1Q 1 | Q 2 | λ Q 1  0Q 0 | 0Q 2 Q 2  1Q 2 Each state in the FA is represented by a variable in the grammar. Each transition symbol in the FA is a terminal in the grammar. Each transition in the FA is represented by a rule in the grammar. If a state, q k is a final state, include the production q k  λ