Presentation is loading. Please wait.

Presentation is loading. Please wait.

The Bov-A2 element is conserved in the NOS2 gene of bovid species.

Published byNeil Bishop Modified over 5 years ago

Similar presentations

Presentation on theme: "The Bov-A2 element is conserved in the NOS2 gene of bovid species."— Presentation transcript:

1 The Bov-A2 element is conserved in the NOS2 gene of bovid species.
The Bov-A2 element is conserved in the NOS2 gene of bovid species. A ∼300 bp region of the cattle TP53 gene and NOS2 gene from cattle, buffalo, bison, and yak were aligned to the consensus BOV-A2 sequence. Candidate transcription factor binding sites derived from analysis with Jaspar are indicated in bold. Asterisks indicate bases conserved across the species. Rachel Young et al. ImmunoHorizons 2018;2:27-37 Copyright © 2018 The Authors

Download ppt "The Bov-A2 element is conserved in the NOS2 gene of bovid species."

Similar presentations

Defining the Regulatory Potential of Highly Conserved Vertebrate Non-Exonic Elements Rachel Harte BME230.

Defining the Regulatory Potential of Highly Conserved Vertebrate Non-Exonic Elements Rachel Harte BME230.
In silico cis-analysis promoter analysis - Promoters and cis-elements - Searching for patterns - Searching redundant patterns.

In silico cis-analysis promoter analysis - Promoters and cis-elements - Searching for patterns - Searching redundant patterns.
An Introduction to ENCODE Mark Reimers, VIPBG (borrowing heavily from John Stamatoyannopoulos and the ENCODE papers)

An Introduction to ENCODE Mark Reimers, VIPBG (borrowing heavily from John Stamatoyannopoulos and the ENCODE papers)
Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.

Figure S1. Genomic PCR of in vitro potato plants transformed with StPTB1 prom (top) and StPTB6 prom (bottom) constructs using nptII-specific primers. Thirty.
Figure S1. Alignment of sequences from the 5′-end to the Sm binding site of reported genomic sequences (9-15) for HSUR 1. MicroRNA binding sites are.

Figure S1. Alignment of sequences from the 5′-end to the Sm binding site of reported genomic sequences (9-15) for HSUR 1. MicroRNA binding sites are.
A high-resolution map of human evolutionary constraints using 29 mammals Kerstin Lindblad-Toh et al. 2011 Presentation by Robert Lewis and Kaylee Wells.

A high-resolution map of human evolutionary constraints using 29 mammals Kerstin Lindblad-Toh et al Presentation by Robert Lewis and Kaylee Wells.
White (2n = 40) Hispanic (2n = 40) Black (2n = 40) Asian (2n = 40) Numbers in diamonds: LD as r 2 *100 LD blocks defined by four gamete rule r 2 color.

White (2n = 40) Hispanic (2n = 40) Black (2n = 40) Asian (2n = 40) Numbers in diamonds: LD as r 2 *100 LD blocks defined by four gamete rule r 2 color.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
Volume 88, Issue 5, Pages (March 1997)

Volume 88, Issue 5, Pages (March 1997)
Phylogenetic characterization of the Bunyavirales-like viruses identified in this study. Phylogenetic characterization of the Bunyavirales-like viruses.

Phylogenetic characterization of the Bunyavirales-like viruses identified in this study. Phylogenetic characterization of the Bunyavirales-like viruses.
CYB561 mutations. CYB561 mutations. The upper part shows the structure of the CYB561 gene, with the positions of the identified mutations indicated. Gray.

CYB561 mutations. CYB561 mutations. The upper part shows the structure of the CYB561 gene, with the positions of the identified mutations indicated. Gray.
Figure 2 Sanger sequencing, conservation, and summary of known ACO2 mutations Sanger sequencing, conservation, and summary of known ACO2 mutations (A)

Figure 2 Sanger sequencing, conservation, and summary of known ACO2 mutations Sanger sequencing, conservation, and summary of known ACO2 mutations (A)
Mark M Metzstein, H.Robert Horvitz  Molecular Cell 

Mark M Metzstein, H.Robert Horvitz  Molecular Cell 
HIF1 binds and stimulates the VEGFA promoter in normoxia.

HIF1 binds and stimulates the VEGFA promoter in normoxia.
14-3-3 binding sites 58 of the 473 unambiguously assigned phosphorylation sites are predicted by Scansite to be sites for 14-3-3 binding. 50 of these correspond.

binding sites 58 of the 473 unambiguously assigned phosphorylation sites are predicted by Scansite to be sites for binding. 50 of these correspond.
Behaviorally dependent allele-specific expression.

Behaviorally dependent allele-specific expression.
Shidou Zhao, Ph. D. , Guangyu Li, M. Sc. , Raymond Dalgleish, Ph. D

Shidou Zhao, Ph. D. , Guangyu Li, M. Sc. , Raymond Dalgleish, Ph. D
CYP3A Variation and the Evolution of Salt-Sensitivity Variants

CYP3A Variation and the Evolution of Salt-Sensitivity Variants
Sequence and comparison of the SDS protein.

Sequence and comparison of the SDS protein.

Similar presentations

Ads by Google