1. Important Implication in Cancer Immunotherapy
The prevalent Boxer MHC class I Dog Leukocyte Antigen (DLA)-88*034:01 preferentially binds nonamer peptides with a defined motif
Important Implication in Cancer Immunotherapy
Paige Nemec
NCSU Ph.D. Student
Department of Clinical Sciences
Consortium for Canine Comparative Oncology (C3O) Symposium
Durham Convention Center
February 23, 2018

2. Tumor cells
Cytotoxic T Cells
T Cell Lymphoma
Glioma

3. FLAG PN62 clone expressing FLAG-tagged DLA-88*034:01
Sequenced peptides
by tandem mass spectrometry
9-mers preferred
Alkaline eluted &
purified peptides

4. Motif Discovery
Anchor
Anchor
TCR Interaction

5. Tumor Antigen: B-RAF
For reference, the V595 position that mutates to E in urothelial carcinomas is shown in blue.
….SIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKRDERPLFPPQILASIELLARSLPKIHRSASEP…
non-synonymous substitution K695I in Boxer melanoma
…LATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPV…
…LATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKIRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPV…

6. Acknowledgments Dr. Paul Hess Jennifer Holmes Alex Kapatos
Duke University Proteomics and
Metabolomics Core Facility
Greg Waitt
Arthur Mosley
Eric Soderblom
American Kennel Club Canine Health Foundation