Presentation is loading. Please wait.

Presentation is loading. Please wait.

Hox Genes Control the Vertebrate A-P Axis

Published byManuela Rubio Modified over 5 years ago

Similar presentations

Presentation on theme: "Hox Genes Control the Vertebrate A-P Axis"— Presentation transcript:

1 Hox Genes Control the Vertebrate A-P Axis

2 Homeodomain protein A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN

3

4 The modular construction of plants

5

6

7  The size of the meristem is controlled by a self-regulating balance between a short-range stimulatory signal produced by cells expressing Wuschel(yellow arrow), and a longer-range inhibitory signal delivered by Clavata3 (red bars).

8

9 Domestication of maize and fish

10

11 A Hierarchy of Inductive Interactions Subdivides the Vertebrate Embryo

12

13

Download ppt "Hox Genes Control the Vertebrate A-P Axis"

Similar presentations

Control over Genes Chapter 15.

Control over Genes Chapter 15.
The Build-up of the Red Sequence at z

The Build-up of the Red Sequence at z
Homeobox Genes Body organisation.

Homeobox Genes Body organisation.
Cell identity and positional information. How does a neuron find its target?

Cell identity and positional information. How does a neuron find its target?
Shoot Development A. Function and organization of the apical meristem

Shoot Development A. Function and organization of the apical meristem
Transcriptional regulation in Eukaryotes The regulatory elements of bacterial, yeast, and human genes.

Transcriptional regulation in Eukaryotes The regulatory elements of bacterial, yeast, and human genes.
Control of Gene Expression

Control of Gene Expression
12 The Genetic Control of Development. Gene Regulation in Development Key process in development is pattern formation = emergence of spatially organized.

12 The Genetic Control of Development. Gene Regulation in Development Key process in development is pattern formation = emergence of spatially organized.
Warm up Mon 11/3/14 Adv Bio 1. What does the phrase “gene regulation” mean? 2. If the lac operon cannot bind to the repressor.. What would be the outcome?

Warm up Mon 11/3/14 Adv Bio 1. What does the phrase “gene regulation” mean? 2. If the lac operon cannot bind to the repressor.. What would be the outcome?
Negative regulatory proteins bind to operator sequences in the DNA and prevent or weaken RNA polymerase binding.

Negative regulatory proteins bind to operator sequences in the DNA and prevent or weaken RNA polymerase binding.
12-5 Gene Regulation.

12-5 Gene Regulation.
Development.

Development.
Cell expansion plays a major role in growth Root cells expand their volume 50 times by expanding lengthwise but not widthwise.

Cell expansion plays a major role in growth Root cells expand their volume 50 times by expanding lengthwise but not widthwise.
Development What causes cell differentiation? Molecular Markers.

Development What causes cell differentiation? Molecular Markers.
Young Leaf Shoot Tip Axillary Bud Node Internode.

Young Leaf Shoot Tip Axillary Bud Node Internode.
Expansion of tandem gene clusters Gene duplication by unequal crossing-over Divergence of coding and regulatory sequences.

Expansion of tandem gene clusters Gene duplication by unequal crossing-over Divergence of coding and regulatory sequences.
TRANSLATION The process of converting the information stored in mRNA into a protein is called translation mRNA carries information from a gene to a structure.

TRANSLATION The process of converting the information stored in mRNA into a protein is called translation mRNA carries information from a gene to a structure.
Developmental Genetics. Three Stages of Development division morphogenesis differentiation.

Developmental Genetics. Three Stages of Development division morphogenesis differentiation.
21.1 – 1 As you learned in chapter 12, mitosis gives rise to two daughter cells that are genetically identical to the parent cell. Yet you, the product.

21.1 – 1 As you learned in chapter 12, mitosis gives rise to two daughter cells that are genetically identical to the parent cell. Yet you, the product.
Young Leaf Shoot Tip Axillary Bud Node Internode.

Young Leaf Shoot Tip Axillary Bud Node Internode.

Similar presentations

Ads by Google