Download presentation
Presentation is loading. Please wait.
Published byAugusta Shelton Modified over 8 years ago
1
Ohio State University Department of Computer Science and Engineering 1 Tools and Techniques for the Data Grid Gagan Agrawal
2
Ohio State University Department of Computer Science and Engineering 2 Grids and Data Grids Grid Computing –Large scale problem solving using resources over the internet –Distributed computing, but across multiple administrative domains Data Grid –Grid with focus on sharing and processing large scale datasets
3
Ohio State University Department of Computer Science and Engineering 3 Scientific Data Analysis on Grid-based Data Repositories Scientific data repositories –Large volume »Gigabyte, Terabyte, Petabyte –Distributed datasets »Generated/collected by scientific simulations or instruments –Data could be streaming in nature Scientific data analysis Data Specification Data Organization Data Extraction Data Movement Data Analysis Data Visualization
4
Ohio State University Department of Computer Science and Engineering 4 Opportunities Scientific simulations and data collection instruments generating large scale data Grid standards enabling sharing of data Rapidly increasing wide-area bandwidths
5
Ohio State University Department of Computer Science and Engineering 5 Existing Efforts Data grids recognized as important component of grid/distributed computing Major topics –Efficient/Secure Data Movement –Replica Selection –Metadata catalogs / Metadata services –Setting up workflows
6
Ohio State University Department of Computer Science and Engineering 6 Open Issues Accessing / Retrieving / Processing data from scientific repositories –Need to deal with low-level formats Integrating tools and services having/requiring data with different formats Support for processing streaming data in a distributed environment Efficient distributed data-intensive applications Developing scalable data analysis applications
7
Ohio State University Department of Computer Science and Engineering 7 Ongoing Projects Automatic Data Virtualization On the fly information integration in a distributed environment Middleware for Processing Streaming Data Supporting Coarse-grained pipelined parallelism Compiling XQuery on Scientific and Streaming Data Middleware and Algorithms for Scalable Data Mining
8
Ohio State University Department of Computer Science and Engineering 8 Outline Automatic Data Virtualization –Relational/SQL –XML/XQuery based Information Integration Middleware for Streaming Data Cluster and Grid-based data mining middleware
9
Ohio State University Department of Computer Science and Engineering 9 Automatic Data Virtualization: Motivation Emergence of grid-based data repositories –Can enable sharing of data in an unprecedented way Access mechanisms for remote repositories –Complex low-level formats make accessing and processing of data difficult Main desired functionality –Ability to select, down-load, and process a subset of data
10
Ohio State University Department of Computer Science and Engineering 10 Data Virtualization An abstract view of data dataset Data Service Data Virtualization By Global Grid Forum’s DAIS working group: A Data Virtualization describes an abstract view of data. A Data Service implements the mechanism to access and process data through the Data Virtualization
11
Ohio State University Department of Computer Science and Engineering 11 Our Approach: Automatic Data Virtualization Automatically create data services –A new application of compiler technology A meta-data descriptor describes the layout of data on a repository An abstract view is exposed to the users Two implementations: –Relational /SQL-based –XML/XQuery based
12
Ohio State University Department of Computer Science and Engineering 12 Relational/SQL Implementation Analysis and Code Generation Extract Service Aggregation Service Meta-data Descriptor User Defined Aggregate Query frontend Select Query Input
13
Ohio State University Department of Computer Science and Engineering 13 Design a Meta-data Description Language Requirements –Specify the relationship of a dataset to the virtual dataset schema –Describe the dataset physical layout within a file –Describe the dataset distribution on nodes of one or more clusters –Specify the subsetting index attributes –Easy to use for data repository administrators and also convenient for our code generation
14
Ohio State University Department of Computer Science and Engineering 14 An Example Oil Reservoir Management –The dataset comprises several simulation on the same grid –For each realization, each grid point, a number of attributes are stored. –The dataset is stored on a 4 node cluster. Component I: Dataset Schema Description [IPARS]// { * Dataset schema name *} REL = short int// {* Data type definition *} TIME = int X = float Y = float Z = float SOIL = float SGAS = float Component II: Dataset Storage Description [IparsData] //{* Dataset name *} //{* Dataset schema for IparsData *} DatasetDescription = IPARS DIR[0] = osu0/ipars DIR[1] = osu1/ipars DIR[2] = osu2/ipars DIR[3] = osu3/ipars
15
Ohio State University Department of Computer Science and Engineering 15 Evaluate the Scalability of Our Tool Scale the number of nodes hosting the Oil reservoir management dataset Extract a subset of interest at the size of 1.3GB The execution times scale almost linearly. The performance difference varies between 5%~34%, with an average difference of 16%.
16
Ohio State University Department of Computer Science and Engineering 16 Comparison with an existing database (PostgreSQL) 6GB data for Satellite data processing. The total storage required after loading the data in PostgreSQL is 18GB. Create Index for both spatial coordinates and S1 in PostgreSQL. No special performance tuning applied for the experiment. No.Description 1SELECT * FROM TITAN; 2SELECT * FROM TITAN WHERE X>=0 AND X =0 AND Y =0 AND Z<=100; 3SELECT * FROM TITAN WHERE DISTANCE(X,Y,Z) < 1000; 4SELECT * FROM TITAN WHERE S1 < 0.01; 5SELECT * FROM TITAN WHERE S1 < 0.5;
17
Ohio State University Department of Computer Science and Engineering 17 Outline Automatic Data Virtualization –Relational/SQL –XML/XQuery based Information Integration Middleware for Streaming Data Coarse-grained pipelined parallelism
18
Ohio State University Department of Computer Science and Engineering 18 XML/XQuery Implementation TEXT … NetCDF RMDB HDF5 XML XQuer y ???
19
Ohio State University Department of Computer Science and Engineering 19 Programming/Query Language High-level declarative languages ease application development –Popularity of Matlab for scientific computations New challenges in compiling them for efficient execution XQuery is a high-level language for processing XML datasets –Derived from database, declarative, and functional languages ! –XPath (a subset of XQuery) embedded in an imperative language is another option
20
Ohio State University Department of Computer Science and Engineering 20 Approach / Contributions Use of XML Schemas to provide high-level abstractions on complex datasets Using XQuery with these Schemas to specify processing Issues in Translation –High-level to low-level code –Data-centric transformations for locality in low-level codes –Issues specific to XQuery »Recognizing recursive reductions »Type inferencing and translation
21
Ohio State University Department of Computer Science and Engineering 21 External Schema XQuery Sources Compiler XML Mapping Service System Architecture logical XML schemaphysical XML schema C++/C
22
Ohio State University Department of Computer Science and Engineering 22 Outline Automatic Data Virtualization –Relational/SQL –XML/XQuery based Information Integration Middleware for Streaming Data Cluster and Grid-based data mining middleware
23
Ohio State University Department of Computer Science and Engineering 23 Overall Goal Tools for data integration driven by: –Data explosion »Data size & number of data sources –New analysis tools –Autonomous resources »Heterogeneous data representation & various interfaces –Frequent Updates –Common Situations: » Flat-file datasets » Ad-hoc sharing of data
24
Ohio State University Department of Computer Science and Engineering 24 Current Approaches Manually written wrappers –Problems »O(N 2 ) wrappers needed, O(N) for a single updates Mediator-based integration systems –Problems »Need a common intermediate format »Unnecessary data transformation Integration using web/grid services »Needs all tools to be web-services (all data in XML?)
25
Ohio State University Department of Computer Science and Engineering 25 Our Approach Automatically generate wrappers –Stand-alone programs –For integrated DBs, (grid) workflow systems Transform data in files of arbitrary formats –No domain- or format-specific heuristics –Layout information provided by users Help biologists write layout descriptors using data mining techniques Particularly attractive for – flat-file datasets – ad hoc data sharing – data grid environments
26
Ohio State University Department of Computer Science and Engineering 26 Our Approach: Advantages Advantages: –No DB or query support required –One descriptor per resource needed –No unnecessary transformation –New resources can be integrated on-the-fly
27
Ohio State University Department of Computer Science and Engineering 27 Our Approach: Challenges Description language –Format and logical view of data in flat files –Easy to interpret and write Wrapper generation and Execution –Correspondence between data items –Separating wrapper analysis and execution Interactive tools for writing layout descriptors –What data mining techniques to use ?
28
Ohio State University Department of Computer Science and Engineering 28 Wrapper Generation System Overview Layout DescriptorSchema Descriptors ParserMapping Generator Data Entry RepresentationSchema Mapping DataReaderDataWriter Synchronizer Source Dataset Target Dataset Application Analyzer WRAPINFO
29
Ohio State University Department of Computer Science and Engineering 29 Layout Description Language Goal –To describe data in arbitrary flat file format –Easy to interpret and write Components: 1.Schema description 2.Layout description Example: FASTA
30
Ohio State University Department of Computer Science and Engineering 30 Layout Description Language Component I: Schema Description [FASTA]//Schema Name ID = string//Data type definitions DESCRIPTION = string SEQ = string … >seq1 comment1 \n ASTPGHTIIYEAVCLHNDRTTIP \n >seq2 comment2 \n ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK \n NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR \n KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES \n >seq3 …
31
Ohio State University Department of Computer Science and Engineering 31 Layout Description Language Key observations on data layout –Strings of variable length –Delimiters widely used –Data fields divided into variables –Repetitive structures Key tokens –“constant string” –LINESIZE –[optional] – –… … >seq1 comment1 \n ASTPGHTIIYEAVCLHNDRTTIP \n >seq2 comment2 \n ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK \n NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR \n KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES \n >seq3 …
32
Ohio State University Department of Computer Science and Engineering 32 Layout Description Language Component II: Layout Description … LOOP ENTRY 1:EOF:1 { “>” ID “ ” DESCRIPTION “\n” | EOF } … >seq1 comment1 \n ASTPGHTIIYEAVCLHNDRTTIP \n >seq2 comment2 \n ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPK \n NMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGR \n KSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARRELVISLIVES \n >seq3 …
33
Ohio State University Department of Computer Science and Engineering 33 Outline Automatic Data Virtualization –Relational/SQL –XML/XQuery based Information Integration Middleware for Streaming Data Coarse-grained pipelined parallelism
34
Ohio State University Department of Computer Science and Engineering 34 Streaming Data Model Continuous data arrival and processing Emerging model for data processing –Sources that produce data continuously: sensors, long running simulations –WAN bandwidths growing faster than disk bandwidths Active topic in many computer science communities –Databases –Data Mining –Networking ….
35
Ohio State University Department of Computer Science and Engineering 35 Summary/Limitations of Current Work Focus on – centralized processing of stream from a single source (databases, data mining) – communication only (networking) Many applications involve – distributed processing of streams – streams from multiple sources
36
Ohio State University Department of Computer Science and Engineering 36 Motivating Application Switch Network X Network Fault Management System
37
Ohio State University Department of Computer Science and Engineering 37 Motivating Application (2) Computer Vision Based Surveillance
38
Ohio State University Department of Computer Science and Engineering 38 Features of Distributed Streaming Processing Applications Data sources could be distributed –Over a WAN Continuous data arrival Enormous volume –Probably can ’ t communicate it all to one site Results from analysis may be desired at multiple sites Real-time constraints –A real-time, high-throughput, distributed processing problem
39
Ohio State University Department of Computer Science and Engineering 39 Need for a Grid-Based Stream Processing Middleware Application developers interested in data stream processing –Will like to have abstracted »Grid standards and interfaces »Adaptation function –Will like to focus on algorithms only GATES is a middleware for –Grid-based –Self-adapting Data Stream Processing
40
Ohio State University Department of Computer Science and Engineering 40 Adaptation for Real-time Processing Analysis on streaming data is approximate Accuracy and execution rate trade-off can be captured by certain parameters (Adaptation parameters) –Sampling Rate –Size of summary structure Application developers can expose these parameters and a range of values
41
Ohio State University Department of Computer Science and Engineering 41 Public class Sampling-Stage implements StreamProcessing{ … void init(){ … } … void work(buffer in, buffer out){ … while(true) { Image img = get-from-buffer-in-GATES(in); Image img-sample = Sampling(img, sampling-ratio); put-to-buffer-in-GATES(img-sample, out); } … } API for Adaptation sampling-ratio = GATES.getSuggestedParameter(); GATES.Information-About-Adjustment-Parameter(min, max, 1)
42
Ohio State University Department of Computer Science and Engineering 42 Outline Automatic Data Virtualization –Relational/SQL –XML/XQuery based Information Integration Middleware for Streaming Data Cluster and Grid-based data mining middleware
43
Ohio State University Department of Computer Science and Engineering 43 Scalable Mining Problem Our understanding of what algorithms and parameters will give desired insights is often limited The time required for creating scalable implementations of different algorithms and running them with different parameters on large datasets slows down the data mining process
44
Ohio State University Department of Computer Science and Engineering 44 Mining in a Grid Environment Mining in a Grid Environment A data mining application in a grid environment - - Needs to exploit different forms of available parallelism - Needs to deal with different data layouts and formats - Needs to adapt to resource availability
45
Ohio State University Department of Computer Science and Engineering 45 FREERIDE Overview Framework for Rapid Implementation of datamining engines Demonstrated for a variety of standard mining algorithm Targeted distributed memory parallelism, shared memory parallelism, and combination Can be used as basis for scalable grid-based data mining implementations Published in SDM 01, SDM 02, SDM 03, Sigmetrics 02, Europar 02, IPDPS 03, IEEE TKDE (to appear)
46
Ohio State University Department of Computer Science and Engineering 46 FREERIDE-G Data processing may not be feasible where the data resides Need to identify resources for data processing Need to abstract data retrieval, movement and parallel processing
47
Ohio State University Department of Computer Science and Engineering 47 Group Members Ph.D students –Liang Chen –Leo Glimcher –Kaushik Sinha –Li Weng –Xuan Zhang –Qian Zhu Recently Graduated –Ruoming Jin (Kent State) –Wei Du (Yahoo) –Xiaogang Li (Wi 06, AskJeeves)
48
Ohio State University Department of Computer Science and Engineering 48 Getting Involved Talk to me Most recent papers are available online Sign in for my 888
Similar presentations
© 2024 SlidePlayer.com Inc.
All rights reserved.