I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Ryo) II. Binding specificity.

Slides:

Advertisements

Similar presentations

Selection of XID target site Ani-wt: T G A G G A G G T T T C T C T G T A A m-XID: A G T G C C T G T T T C T C T T G A C –7 –6 –5 -4 –3 –2 –1.

Advertisements

Yupeng. Yeast surface Aga1p s s s s Aga2p I-AniI Myc 3’-ACTCCTCCAAAGAGACATT 5’-TGAGGAGGTTTCTCTGTAA Biotin Ani-wt: T G A G G A G G T T T C T C T G T A.

X-inactivation 20/11/08.

Ameer Effat M. Elfarash Dept. of Genetics Fac. of Agriculture, Assiut Univ. Gene Expression.

Directed Evolution of a Fungal Peroxidase Irene Woo Enzong Yap Joel R. Cherry et al.

Biology Mathematics Engineering Optics Physics Robotics Informatics.

Establishment of HIV-1 resistance in CD4 + T cells by genome editing using zinc-finger nucleases Elena E Perez, Jianbin Wang, Jeffrey C Miller, Yann Jouvenot,

Restriction Endonucleases (Molecular Scissors) By Amr S. Moustafa, M.D.; Ph.D. Assistant Prof. & Consultant, Medical Biochemistry Dept. College of Medicine,

Lecture 9- T cell development Flow cytometry- how it works Thymic architecture and cells Thymic development I- generation of a TCR  chain Thymic development.

Selection of XID(Btk) site specific I-AniI variant for gene repair in hematopoietic stem cells Yupeng Wang Rawlings Lab Center for Immunity and Immunotherapy.

Polymerase Chain Reaction (PCR) and Its Applications by Ayaz Najafov Boğaziçi University Department of Molecular Biology and Genetics.

2 March, 2005 Chapter 12 Mutational dissection Normal gene Altered gene with altered phenotype mutagenesis.

Recombinant DNA Technology

What makes DNA Computing possible? Great advances in molecular biology –PCR (Polymerase Chain Reaction) –DNA Selection by affinity –DNA Filtering –DNA.

SNP Discovery in the Human Genome C244/144 November 21, 2005.

1 Directed Mutagenesis and Protein Engineering. 2 Mutagenesis Mutagenesis -> change in DNA sequence -> Point mutations or large modifications Point mutations.

I.1 ii.2 iii.3 iv.4 1+1=. i.1 ii.2 iii.3 iv.4 1+1=

3 September, 2004 Chapter 20 Methods: Nucleic Acids.

Study and engineering of gene function: mutagenesis I. Why mutagenize? II. Random mutagenesis, mutant selection schemes III. Site-directed mutagenesis,

I.1 ii.2 iii.3 iv.4 1+1=. i.1 ii.2 iii.3 iv.4 1+1=

Tasha A. Desai, Dmitry A. Rodionov, Mikhail S. Gelfand, Eric J. Alm, and Christopher V. Rao 1 Alvin Chen April 14, 2010.

Forward genetics and reverse genetics

Scharenberg Lab Technical update on yeast display (Hoku/Jordan) –Overhang length can influence binding (see meeting notes) –Half sites can be interrogated.

Turning Cro into a Transcriptional Activator Fred Bushman and Mark Ptashne Cell (1988) 54: Presented by Drew Endy and Natalie Kuldell for /

Microbial Biotechnology Philadelphia University

15.3 Gene Technologies in Detail Mrs. Stipanovich.

Protein Engineering BIT 230. Protein Engineering Design and construction of proteins by recombinant DNA techniques Michael Smith developed using oligonucleotide.

PCR Related Products.

Gene repair in murine hematopoietic stem cells (NGEC Component 6) Aim 1: Develop and test a murine X-linked severe combined immunodeficiency (XSCID) model.

Stoddard Lab Activities 1.Structural biology of design work: I-MsoI cluster designs vs. individual designs (Justin Ashworth and Greg Taylor) 2.Binding.

Genetics and Biotechnology

Gene repair in murine hematopoietic stem cells (NGEC Component 6) Aim 1: Develop murine X-linked severe combined immunodeficiency (XSCID) models for I-SceI.

Biotechnology Chapter 17.

Different approaches: Site degeneracy data from libraries with randomized target sites (in vitro, complexity of the initial library is crucial, involves.

Prokaryotes vs Eukaryotes

Stoddard Lab Immediate Goals (Nov-Dec 2007) Optimization of I-AniI wild-type site recognition/I-AniI stability and generation of in vivo activity (bacterial.

Monnat Lab progress monomerizations of Cre, Mso (Hui) 2 nd round designs vs. Anopheles targets (Umut) in vivo recombination reporter assays (Ray, Hui)

YSD: Engineering Molecular Interactions Target protein is on the surface – biophysical characterization of binding by flow cytometry High-throughput &

Puzzling Low Surface Expression of H-DreI-B7 in IgL-targeted Clones Dre #4Dre #3Dre #2 Dre #3 Dre #2 IgM-FITC HA-APC dsOligo-Biotin/SAv-PE Cell count (%)

Molecular Cloning.

Virology 1.5-Genetics Some terminology from the last part of Chapter 3.

NGEC Applications Meeting Mike Certo Scharenberg Lab.

Strategy of Redesign for CTLMA2 Target Site AniI WT: TGAGGAGGTTTCTCTGTAAA || | ||| ||||| || CTLMA2 : AGAAGCCGTTCATCTGTCAA -7A -10A/-7A -5C/-4C Semi-saturation.

Molecular Cloning. Definitions   Cloning :   Obtaining a piece of DNA from its original source (Genome) and introducing it in a DNA vector   Sub-cloning:

Affinity tuning of antibodies using yeast surface display.

Da-Hyeong Cho Protein Engineering Laboratory Department of Biotechnology and Bioengineering Sungkyunkwan University Site-Directed Mutagenesis.

Site-Directed Mutagenesis

Group meeting Mahavir Singh 01/19/2010 Tetrahymena p65 And Shq1, a H/ACA related protein 1.

Basic Tools: Recombinant DNA Techniques Cut Purified DNA with Restriction Enzymes Transform E. coli Purified plasmid DNA Various restriction enzymes T4.

Recombinant DNA (DNA Cloning)

Monomerization of Homing Endonucleases

B. Tech. (Biotechnology) III Year V th Semester

Molecular Cloning: Polymerase Chain Reaction

The Molecular Basis of Inheritance

Protein Engineering Protein engineering Industrial enzymes (Table 8.1)

In vivo optimization of the tagging approach using the Act5C model locus and flow cytometry-based quantification of the Act5C-GFP tagging success. In vivo.

710.LC GRADUATE MOLECULAR BIOLOGY 9/15/2010

William Chiuman, Yingfu Li Chemistry & Biology

Directed Mutagenesis and Protein Engineering

Polymerase Chain Reaction (PCR).

Sequence Diversity, Metal Specificity, and Catalytic Proficiency of Metal-Dependent Phosphorylating DNA Enzymes Wei Wang, Lieven P Billen, Yingfu Li

Sequence Diversity, Metal Specificity, and Catalytic Proficiency of Metal-Dependent Phosphorylating DNA Enzymes Wei Wang, Lieven P Billen, Yingfu Li

Melissa S Jurica, Raymond J Monnat, Barry L Stoddard Molecular Cell

A B C p= ns 4T1BR5 GFP expression P10 P20 4T1BR5-Fluc-GFP Count

Hayun Lee, Yi Zhou, David W. Taylor, Dipali G. Sashital Molecular Cell

The Pro162 Variant is a Loss-of-Function Mutation of the Human Melanocortin 1 Receptor Gene Celia Jiménez-Cervantes, Concepción Olivares, Petra González,

Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii. Tagging of the endogenous Py03652 gene with the gfp gene in Plasmodium yoelii.

Volume 25, Issue 4, Pages e3 (October 2018)

U A B II III I IV 94.

Presentation transcript:

I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Ryo) II. Binding specificity profiles: I-CreI, I-MsoI, I-AniI (WT vs. wt, WT vs. lib4, WT-opt vs. wt), I-SspI III. Crystal Structures: Single Chain I-MsoI Crystallization trials continuing with I-AniI vs. lib4 I-MsoI designs (Justin Ashworth/Greg Taylor) IV.I-AniI nickase: Metal and pH dependence, binding affinity, relative cleavage Recombination in cellulo (with Stefan Pellenz/Ray Monnat)

I-AniI variants working in bacteria-based cleavage assay * * ** Clones resulting from random mutagenesis and selection Clones resulting from site-directed mutagenesis

Mutations improving the cleavage activity of I-AniI F13Y I55V S111Y 90° rotation F91IS92T

In vitro cleavage asssay (kDa)WTY2M5

CD spectrum and thermal stability of I-AniI variants Buffer : 10 mM potassium phosphate (pH 7.0) Tm : WT, 53.9 °C; Y2, 52.6 °C; M5, 43.5 °C.

Future Work Binding assay to AniI wt and Lib4 sites GFP recombination assay with I-AniI/Y2 (Crystallization of I-AniI/Y2 with DNA) Engineering of I-AniI variants specifically cleaving CTLMA2 site

I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Audrey) II. Binding specificity profiles: I-CreI, I-MsoI, I-AniI (WT vs. wt, WT vs. lib4, WT-opt vs. wt), I-SspI III. Crystal Structures: Single Chain I-MsoI Crystallization trials continuing with I-AniI vs. lib4 I-MsoI designs (Justin Ashworth/Greg Taylor) IV.I-AniI nickase: Metal and pH dependence, binding affinity, relative cleavage Recombination in cellulo (with Stefan Pellenz/Ray Monnat)

A 19 bp sequence within the CFTR gene is similar to the I-AniI target sequence  508  Goal: Generate an I-AniI variant that specifically recognizes this site

Staining identifies two variants of CFTR target site for selection experiments Cell count (% of maximum) dsOligo-BT:SAv-PE WT-2C-2C+6A-2C+8C+9T-2C+6A+8C+9T WT DT40 I-AniI (3D5) WT Site-2C-2C+6A-2C+8C+9T-2C+6A+8C+9T

I-AniI, WT WT DT40 I-AniI population binds selected target oligos with high affinity after 4 iterative mutation/selection rounds WT Site-2C-2C+6A-2C+8C+9T I-AniI -2C+6A selection I-AniI, -2C+8C+9T selection WT-2C-2C+6A-2C+8C+9T Target site variant I-AniI target site binding

WT Site I-AniI, WT WT DT40 -2C-2C+6A-2C+8C+9T I-AniI -2C+6A selection I-AniI, -2C+8C+9T selection WT-2C-2C+6A-2C+8C+9T Target site variant I-AniI target site binding Selected I-AniI population maintains ability to discriminate between similar DNA sequences I-AniI population binds selected target oligos with high affinity after 4 iterative sorting/selection rounds

G33R mutation is fixed in selected populations: present in 93/96 sequenced I-AniI clones MGSSHHHHHHSSGLVPRGSDLTYAYLVGLFEGDGYFSITKKGKYLTYELR IELSIKDVQLIYKIKKILGIGIVSFRKRNEIEMVALRIRDKNHLKSFILP IFEKYPMFSNKQYDYLRFRNALLSGIISLEDLPDYTRSDEPLNSIESIIN TSYFSAWLVGFIEAEGCFSVYKLNKDDDYLIASFDIAQRDGDILISAIRK YLSFTTKVYLDKTNCSKLKVTSVRSVENIIKFLQNAPVKLLGNKKLQYLL WLKQLRKISRYSEKIKIPSNY G33R

I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Audrey) II. Binding specificity profiles: I-CreI, I-MsoI, I-AniI (WT vs. wt, WT vs. lib4, WT-opt vs. wt), I-SspI III. Crystal Structures: Single Chain I-MsoI Crystallization trials continuing with I-AniI vs. lib4 I-MsoI designs (Justin Ashworth/Greg Taylor) IV.I-AniI nickase: Metal and pH dependence, binding affinity, relative cleavage Recombination in cellulo (with Stefan Pellenz/Ray Monnat)

Flow cytometry analysis of CTLMA2 targets 5’ TGAGGAGGTTTCTCTGTAA 3’ 5’ AGAGGACCTTCATCTGTCA 3’ I-AniI WT: I-AniI CTLMA2:

I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Audrey) II. Binding specificity profiles: I-CreI, I-MsoI, I-AniI (WT vs. wt, WT vs. lib4, WT-opt vs. wt), I-SspI III. Crystal Structures: Single Chain I-MsoI Crystallization trials continuing with I-AniI vs. lib4 I-MsoI designs (Justin Ashworth/Greg Taylor) IV.I-AniI nickase: Metal and pH dependence, binding affinity, relative cleavage Recombination in cellulo (with Stefan Pellenz/Ray Monnat)

I-AniI I- CreI I-MsoI

I. Selections: I-AniI for wild-type site binding/cleavage: “WT-opt” (Ryo) I-AniI towards hCF (Audrey) I-AniI towards A.gam. CTLMA2 (Audrey) II. Binding specificity profiles: I-CreI, I-MsoI, I-AniI (WT vs. wt, WT vs. lib4, WT-opt vs. wt), I-SspI III. Crystal Structures: Single Chain I-MsoI Crystallization trials continuing with I-AniI vs. lib4 I-MsoI designs (Justin Ashworth/Greg Taylor) IV.I-AniI nickase: Metal and pH dependence, binding affinity, relative cleavage Recombination in cellulo (with Stefan Pellenz/Ray Monnat)