PDB-Protein Data Bank SCOP –Protein structure classification CATH –Protein structure classification genTHREADER–3D structure prediction Swiss-Model–3D.

Slides:

Advertisements

Similar presentations

LSM2104/CZ2251 Essential Bioinformatics and Biocomputing Essential Bioinformatics and Biocomputing Protein Structure and Visualization (2) Chen Yu Zong.

Advertisements

Web Resources for Bioinformatics Vadim Alexandrov and Mark Gerstein.

PROTEOMICS 3D Structure Prediction. Contents Protein 3D structure. –Basics –PDB –Prediction approaches Protein classification.

Pfam(Protein families )

PDB-Protein Data Bank SCOP –Protein structure classification CATH –Protein structure classification genTHREADER–3D structure prediction Swiss-Model–3D.

1 Protein Structure, Structure Classification and Prediction Bioinformatics X3 January 2005 P. Johansson, D. Madsen Dept.of Cell & Molecular Biology, Uppsala.

Protein Tertiary Structure Prediction

Tema 14. Bases of protein structure and structural prediction. Structural data bank. Protein Data Bank. Molecular Visualization Tools for 3D. Prediction.

Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]

Protein structure. Amino acids Amino acids: R group properties.

Strict Regularities in Structure-Sequence Relationship

Protein secondary structure prediction methods TDVEAAVNSLVNLYLQASYLS “From sequence to structure”

Protein secondary structure prediction methods TDVEAAVNSLVNLYLQASYLS “From sequence to structure”

Protein structure (Part 2 of 2).

Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]

Tertiary protein structure viewing and prediction July 5, 2006 Learning objectives- Learn how to manipulate protein structures with Deep View software.

Protein secondary structure prediction methods TDVEAAVNSLVNLYLQASYLS “From sequence to structure”

The Protein Data Bank (PDB)

ProteinStructuralDatabases. Proteins are built from amino-acids. Introduction H | NH2-c-CO2H | R.

CISC667, F05, Lec20, Liao1 CISC 467/667 Intro to Bioinformatics (Fall 2005) Protein Structure Prediction Protein Secondary Structure.

Protein Tertiary Structure. Primary: amino acid linear sequence. Secondary:  -helices, β-sheets and loops. Tertiary: the 3D shape of the fully folded.

Protein Structure and Function Prediction. Predicting 3D Structure –Comparative modeling (homology) –Fold recognition (threading) Outstanding difficult.

Protein Tertiary Structure Prediction Structural Bioinformatics.

Protein structures in the PDB

Protein structure Classification Ole Lund, Associate professor, CBS, DTU.

BLOSUM Information Resources Algorithms in Computational Biology Spring 2006 Created by Itai Sharon.

Introduction to Bioinformatics - Tutorial no. 8 Predicting protein structure PSI-BLAST.

Protein Structure Prediction II

Introduction to Bioinformatics - Tutorial no. 8 Protein Prediction: - PROSITE - Pfam - SCOP - TOPITS - genThreader.

Protein Tertiary Structure Prediction Structural Bioinformatics.

Protein Structures.

Protein Structure Prediction and Analysis

Current Status of Homology Modeling Using MCSG Structures 319 MCSG structures in PDB have over 400,000 sequence homologues. These structures represent.

Protein Tertiary Structure Prediction

Structural alignment Protein structure Every protein is defined by a unique sequence (primary structure) that folds into a unique.

Macromolecular structure

Practical session 2b Introduction to 3D Modelling and threading 9:30am-10:00am 3D modeling and threading 10:00am-10:30am Analysis of mutations in MYH6.

COMPARATIVE or HOMOLOGY MODELING

Protein 3D-structure analysis Exercises. Practicals Find update frequency for RCSB PDB: weekly. When was the last update? How many protein structures.

Gene Annotation and Analysis Lab Work Reference: European Multimedia Bioinformatics Educational Resource.

Bioinformatics 2 -- Lecture 8 More TOPS diagrams Comparative modeling tutorial and strategies.

1 P9 Extra Discussion Slides. Sequence-Structure-Function Relationships Proteins of similar sequences fold into similar structures and perform similar.

© Wiley Publishing All Rights Reserved. Protein 3D Structures.

CATH – a hierarchic classification of protein domain structures Rui Kuang.

Neural Networks for Protein Structure Prediction Brown, JMB 1999 CS 466 Saurabh Sinha.

PROTEIN STRUCTURE CLASSIFICATION SUMI SINGH (sxs5729)

1 Enter the following Micro-RNA sequence into the box Run MFold and look at the results MFold Using MFold to predict RNA secondary structure

Part I : Introduction to Protein Structure A/P Shoba Ranganathan Kong Lesheng National University of Singapore.

Protein Structure & Modeling Biology 224 Instructor: Tom Peavy Nov 18 & 23, 2009

Protein Strucure Comparison Chapter 6,7 Orengo. Helices α-helix4-turn helix, min. 4 residues helix3-turn helix, min. 3 residues π-helix5-turn helix,

Protein Tertiary Structure. Protein Data Bank (PDB) Contains all known 3D structural data of large biological molecules, mostly proteins and nucleic acids:

Protein Sequence Analysis - Overview - NIH Proteomics Workshop 2007 Raja Mazumder Scientific Coordinator, PIR Research Assistant Professor, Department.

Homology modeling with SWISS-MODEL

DDPIn Distance and Density Based Protein Indexing David Hoksza Charles University in Prague Department of Software Engineering Czech Republic.

March 28, 2002 NIH Proteomics Workshop Bethesda, MD Lai-Su Yeh, Ph.D. Protein Scientist, National Biomedical Research Foundation Demo: Protein Information.

Guidelines for sequence reports. Outline Summary Results & Discussion –Sequence identification –Function assignment –Fold assignment –Identification of.

Structural classification of Proteins SCOP Classification: consists of a database Family Evolutionarily related with a significant sequence identity Superfamily.

Protein Tertiary Structure Prediction Structural Bioinformatics.

Proteins Structure Predictions Structural Bioinformatics.

3.3b1 Protein Structure Threading (Fold recognition) Boris Steipe University of Toronto (Slides evolved from original material.

Protein Sequence, Structure, and Function Lab Gustavo Caetano - Anolles Protein Sequence, Structure, and Function Lab v1 | Gustavo Caetano - Anolles 1.

Sequence: PFAM Used example: Database of protein domain families. It is based on manually curated alignments.

Two Different Approaches to Protein Structure Modeling

Chapter 14 Protein Structure Classification

Bio/Chem-informatics

Classification: understanding the diversity and principles of

Protein Structures.

Protein structure prediction.

Protein Structural Classification

Neural Networks for Protein Structure Prediction Dr. B Bhunia.

Presentation transcript:

PDB-Protein Data Bank SCOP –Protein structure classification CATH –Protein structure classification genTHREADER–3D structure prediction Swiss-Model–3D structure prediction ModBase-A database of 3D struc. Predict. Protein Structure Prediction II

PDB file Accession number Java based visualization tools Structural Classification

PDB provides the atomic coordinates of the structure : Which can be viewed by different visualization tools

SCOP: Structural Classification of Proteins Based on known protein structures Manually created by visual inspection Hierarchical database structure: –Class, Fold, Superfamily, Family, Protein and Species

Parents of node Children of node Node

Parents of node Children of node Node

CATH: Protein Structure Classification by Class, Architecture, Topology and Homology Class: The secondary structure composition: mainly-alpha, mainly-beta and alpha-beta. Architecture: The overall shape of the domain structure. Orientations of the secondary structures : e.g. barrel or 3- layer sandwich. Topology: Structures are grouped into fold groups at this level depending on both the overall shape and connectivity of the secondary structures. Homologous Superfamily: Evolutionary conserved structures

CATH: Protein Structure Classification by Class, Architecture, Topology and Homology

genTHREADER Input sequence Type of Analysis (PSIPRED,MEMSAT, genTHREAD)

GenTHREADER Output

GenTHREADER Output The output sequences show some extent of sequence homology But high level of secondary structure conservation

SWISS-MODEL An automated protein modeling server.

SWISS-MODEL The SWISS-MODEL algorithm can be divided into three steps: 1.Search for suitable templates: the server finds all similarities of a query sequence to sequences of known structure. It uses the BLASTP2 program with the ExNRL-3D database (a derivative of PDB database, specified for SWISS-MODEL). You get these partial results as a SwissModel TraceLog file. 2.Check sequence identity with target: All templates with sequence identities above 25% are selected 3.Create the model using the ProModII program. You get this as a SwissModel-Model file.

SWISS-MODEL Get PDB file by Load to J-Mol

Single Structure Homology Modeling

Swiss-Model file Structures used for the homology model query

Comparative Modeling Accuracy of the comparative model is related to the sequence identity on which it is based >50% sequence identity = high accuracy 30%-50% sequence identity= 90% modeled <30% sequence identity =low accuracy (many errors)

ModBase A Homology Model Database

Ligand Binding Site

Excersize The sequence below belongs to the Prion that causes the “mad cow” disease. This protein becomes toxic when it gets into the brain and misfolds causing native cellular prions to deform and aggregate. In structural terms, the prion toxicity in leaded by a folding change into an instable structure. >PRION_1ag2 GLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQ HTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYY Use PSIpred, geneTHREADER and PROFsec in order to predict its secondary and tertiary structures. Based on the secondary and tertiary structure predictions 1.Can you suggest the region which could be responsible for the structural instability? 2.What is the secondary structure in the real solved structure? 3.What is the expected structural change in this region?

PSIPRED

geneTHREADER

PROFsec

Answer : alpha helix geneTHREADER turn into B-sheet PSIPRED anf PROFsec, prediction in this area are not consistent in the different tools.