Protein structure and homology modeling Morten Nielsen, CBS, BioCentrum, DTU

Objectives Understand the basic concepts of homology modeling Learn why even sequences with very low sequence similarity can be modeled –Understand why is %id such a terrible measure for reliability See the beauty of sequence profiles? Learn where to find the best public methods

Outline Why homology modeling How is it done How to decide when to use homology modeling –Why is %id such a terrible measure What are the best methods? Models in immunology

Why protein modeling? Because it works! –Close to 50% of all new sequences can be homology modeled Experimental effort to determine protein structure is very large and costly The gap between the size of the protein sequence data and protein structure data is large and increasing

Homology modeling and the human genome

Swiss-Prot database ~ in Swiss-Prot ~ if include Tremble

PDB New Fold Growth The number of unique folds in nature is fairly small (possibly a few thousands) 90% of new structures submitted to PDB in the past three years have similar structural folds in PDB New folds Old folds New PDB structures

Identification of fold If sequence similarity is high proteins share structure (Safe zone) If sequence similarity is low proteins may share structure (Twilight zone) Most proteins do not have a high sequence homologous partner Rajesh Nair & Burkhard Rost Protein Science, 2002, 11,

Why %id is so bad!! 1200 models sharing 25-95% sequence identity with the submitted sequences (

Identification of correct fold % ID is a poor measure –Many evolutionary related proteins share low sequence homology Alignment score even worse –Many sequences will score high against every thing (hydrophobic stretches) P-value or E-value more reliable

What are P and E values? E-value –Number of expected hits in database with score higher than match –Depends on database size P-value –Probability that a random hit will have score higher than match –Database size independent Score P(Score) Score hits with higher score (E=10) hits in database => P=10/10000 = 0.001

How to do it Identify fold (template) for modeling –Find the structure in the PDB database that resembles your new protein the most –Can be used to predict function Align protein sequence to template –Simple alignment methods –Sequence profiles –Threading methods –Pseudo force fields Model side chains and loops

Template identification Simple sequence based methods –Align (BLAST) sequence against sequence of proteins with known structure (PDB database) Sequence profile based methods –Align sequence profile (Psi-BLAST) against sequence of proteins with known structure (PDB) –Align sequence profile against profile of proteins with known structure (FFAS) Sequence and structure based methods –Align profile and predicted secondary structure against proteins with known structure (3D-PSSM)

Sequence profiles In conventional alignment, a scoring matrix (BLOSUM62) gives the score for matching two amino acids –In reality not all positions in a protein are equally likely to mutate –Some amino acids (active cites) are highly conserved, and the score for mismatch must be very high –Other amino acids are mutate almost for free, and the score for mismatch is lower than the BLOSUM score Sequence profiles can capture these differences

Protein world Protein fold Protein structure classification Protein superfamily Protein family New Fold

ADDGSLAFVPSEF--SISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLN TVNGAI--PGPLIAERLKEGQNVRVTNTLDEDTSIHWHGLLVPFGMDGVPGVSFPG---I -TSMAPAFGVQEFYRTVKQGDEVTVTIT-----NIDQIED-VSHGFVVVNHGVSME---I IE--KMKYLTPEVFYTIKAGETVYWVNGEVMPHNVAFKKGIV--GEDAFRGEMMTKD--- -TSVAPSFSQPSF-LTVKEGDEVTVIVTNLDE------IDDLTHGFTMGNHGVAME---V ASAETMVFEPDFLVLEIGPGDRVRFVPTHK-SHNAATIDGMVPEGVEGFKSRINDE---- TVNGQ--FPGPRLAGVAREGDQVLVKVVNHVAENITIHWHGVQLGTGWADGPAYVTQCPI Sequence profiles Conserved Non-conserved Matching any thing but G => large negative score Any thing can match TKAVVLTFNTSVEICLVMQGTSIV----AAESHPLHLHGFNFPSNFNLVDPMERNTAGVP TVNGQ--FPGPRLAGVAREGDQVLVKVVNHVAENITIHWHGVQLGTGWADGPAYVTQCPI

Sequence profiles Align (BLAST) sequence against large sequence database (Swiss-Prot) Select significant alignments and make profile (weight matrix) using techniques for sequence weighting and pseudo counts Use weight matrix to align against sequence database to find new significant hits Repeat 2 and 3 (normally 3 times!)

Example. >1K7C.A TTVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADV VTAGDYVIVEFGHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKL FTAKGAKVILSSQTPNNPWETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETL GNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSLKSVLTTTSFEGTCL What is the function Where is the active site?

Example. Function Run Blast against PDB No significant hits Run Blast against NR (Sequence database) Function is Acetylesterase? Where is the active site?

Example. Where is the active site? 1WAB Acetylhydrolase 1G66 Acetylxylan esterase 1USW Hydrolase

Example. Where is the active site? Align sequence against structures of known acetylesterase, like 1WAB, 1FXW, … Cannot be aligned. Too low sequence similarity 1K7C.A 1WAB._ RMSD QAL 1K7C.A 71 GHNDGGSLSTDNGRTDCSGTGAEVCYSVYDGVNETILTF DAL 1WAB._ 160 GHPRAHFLDADPGFVHSDGTISH--HDMYDYLHLSRLGY

Example. Where is the active site? Sequence profiles might show you where to look! The active site could be around S9, G42, N74, and H195

Example. Where is the active site? Align using sequence profiles ALN 1K7C.A 1WAB._ RMSD = K7C.A TVYLAGDSTMAKNGGGSGTNGWGEYLASYLSATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTDN S G N 1WAB._ EVVFIGDSLVQLMHQCE---IWRELFS---PLHALNFGIGGDSTQHVLW--RLENGELEHIRPKIVVVWVGTNNHG K7C.A GRTDCSGTGAEVCYSVYDGVNETILTFPAYLENAAKLFTAK--GAKVILSSQTPNNPWETGTFVNSPTRFVEYAEL-AAEVA 1WAB._ HTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQ-HPNPLREKNRRVNELVRAALAGHP 1K7C.A GVEYVDHWSYVDSIYETLGNATVNSYFPIDHTHTSPAGAEVVAEAFLKAVVCTGTSL H 1WAB._ RAHFLDADPG---FVHSDG--TISHHDMYDYLHLSRLGYTPVCRALHSLLLRL---L

Structural superposition Blue: 1K7C.A Red: 1WAB._

Where was the active site? Rhamnogalacturonan acetylesterase (1k7c)

Including structure Sequence with in a protein superfamily share remote sequence homology, but they share high structural homology Structure is known for template Predict structural properties for query –Secondary structure –Surface exposure Position specific gap penalties derived from secondary structure and surface exposure

Using structure Sequence&structure profile-profile based alignments –Template profiles Multiple structure alignments Sequence based profiles –Query profile Sequence based profile Predicted secondary structure –Position specific gap penalties derived from secondary structure

Structure biased alignment (3D-PSSM)

CASP. Which are the best methods Critical Assessment of Structure Predictions Every second year Sequences from about-to-be-solved- structures are given to groups who submit their predictions before the structure is published Modelers make prediction Meeting in December where correct answers are revealed

CASP6 results

The top 4 homology modeling groups in CASP6 All winners use consensus predictions – The wisdom of the crowd Same approach as in CASP5! Nothing has happened in 2 years!

The Wisdom of the Crowds The Wisdom of Crowds. Why the Many are Smarter than the Few. James Surowiecki One day in the fall of 1906, the British scientist Fracis Galton left his home and headed for a country fair… He believed that only a very few people had the characteristics necessary to keep societies healthy. He had devoted much of his career to measuring those characteristics, in fact, in order to prove that the vast majority of people did not have them. … Galton came across a weight-judging competition…Eight hundred people tried their luck. They were a diverse lot, butchers, farmers, clerks and many other no-experts…The crowd had guessed … pounds, the ox weighted 1.198

The wisdom of the crowd! –The highest scoring hit will often be wrong Not one single prediction method is consistently best –Many prediction methods will have the correct fold among the top hits –If many different prediction methods all have a common fold among the top hits, this fold is probably correct

3D-Jury (Best group) Inspired by Ab initio modeling methods –Average of frequently obtained low energy structures is often closer to the native structure than the lowest energy structure Find most abundant high scoring model in a list of prediction from several predictors 1.Use output from a set of servers 2.Superimpose all pairs of structures 3.Similarity score S ij = # of C a pairs within 3.5Å (if #>40;else S ij =0) 4.3D-Jury score = S ij S ij /(N+1) Similar methods developed by A Elofsson (Pcons) and D Fischer (3D shotgun)

How to do it? Where is the crowd Meta prediction server –Web interface to a list of public protein structure prediction servers –Submit query sequence to all selected servers in one go

Meta Server Evaluating the crowd.

Meta Server Evaluating the crowd. 3D Jury

From fold to structure Flying to the moon has not made man conquer space Finding the right fold does not allow you to make accurate protein models –Can allow prediction of protein function Alignment is still a very hard problem –Most protein interactions are determined by the loops, and they are the least conserved parts of a protein structure

Modeling of newfold proteins Only when every thing else fails Challenge Close to impossible to model Natures folding potential Ab initio protein modeling

New folds are in general constructed from a set of subunits, where each subunit is part of a known fold. The subunits are small compared to the overall fold of the protein. No objective function exists to guide the global packing of the subunits. d ij = 6Å Objective function s ij = 120aa Challenge. Folding potential

Fragments with correct local structure Natures potential Empirical potential A way to solution Glue structure piece wise from fragments. Guide process by empirical/statistical potential

Example (Rosetta web server) Rosetta prediction Structure

Take home message Identifying the correct fold is only a small step towards successful homology modeling Do not trust % ID or alignment score to identify the fold. Use p-values Use sequence profiles and local protein structure to align sequences Do not trust one single prediction method, use consensus methods (3D Jury) Only if every things fail, use ab initio methods