12.1. 12.2 The BioPerl project is an international association of developers of open source Perl tools for bioinformatics, genomics and life science research.

Slides:



Advertisements
Similar presentations
Lecture 6 More advanced Perl…. Substitute Like s/// function in vi: #cut with EcoRI and chew back $linker = “GGCCAATTGGAAT”; $linker =~ s/CAATTG/CG/g;
Advertisements

INTRODUCTION TO BIOPERL Gautier Sarah & Gaëtan Droc.
On line (DNA and amino acid) Sequence Information Lecture 7.
HCS806 “Methods in Horticulture and Crop Science” Introduction to methods in Bioinformatics for plant science. David Francis (Coordinator) Ian Holford.
Lane Medical Library & Knowledge Management Center Perl Programming for Biologists PART 2: Tue Aug 28 th 2007 Yannick Pouliot,
GENBANK, SWISSPROT AND OTHERS As Problem Sources for CSE 549 Andriy Tovkach Genetics.
12.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה.
Advanced Perl for Bioinformatics Lecture 5. Regular expressions - review You can put the pattern you want to match between //, bind the pattern to the.
11ex.1 Modules and BioPerl. 11ex.2 sub reverseComplement { my ($seq) $seq =~ tr/ACGT/TGCA/; $seq = reverse $seq; return $seq; } my $revSeq = reverseComplement("GCAGTG");
1.1 Perl Programming for Biology The Bioinformatics Unit G.S. Wise Faculty of Life Science Tel Aviv University, Israel March 2009 Eyal Privman and Dudu.
13.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה.
14.1 Wrapping up Revision 14.3 References are your friends…
1 Perl Programming for Biology The Bioinformatics Unit G.S. Wise Faculty of Life Science Tel Aviv University, Israel October 2009 By Eyal Privman and Dudu.
1 Perl Programming for Biology The Bioinformatics Unit G.S. Wise Faculty of Life Science Tel Aviv University, Israel January 2009 By Eyal Privman
Sequence Alignment Storing, retrieving and comparing DNA sequences in Databases. Comparing two or more sequences for similarities. Searching databases.
12ex.1. 12ex.2 The BioPerl project is an international association of developers of open source Perl tools for bioinformatics, genomics and life science.
Bioperl modules.
13.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה.
How to use the web for bioinformatics Ethan Strauss X 1171
Data retrieval BioMart Data sets on ftp site MySQL queries of databases Perl API access to databases Export View.
Sequence Alignment Topics: Introduction Exact Algorithm Alignment Models BioPerl functions.
Advanced Perl for Bioinformatics Lecture 5. Regular expressions - review You can put the pattern you want to match between //, bind the pattern to the.
BioPerl. cpan Open a terminal and type /bin/su - start "cpan", accept all defaults install Bio::Graphics.
Login: BITseminar Pass: BITseminar2011 Login: BITseminar Pass: BITseminar2011.
13.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה.
BioPerl - documentation Bioperl tutorial tutorial Mastering Perl for Bioinformatics: Introduction.
Parsing data records. >sp|P31946|1433B_HUMAN protein beta/alpha OS=Homo sapiens MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY.
Basic Introduction of BLAST Jundi Wang School of Computing CSC691 09/08/2013.
MCB 5472 Assignment #5: RBH Orthologs and PSI-BLAST February 19, 2014.
BioPython Workshop Gershon Celniker Tel Aviv University.
BioPerl Based on a presentation by Manish Anand/Jonathan Nowacki/ Ravi Bhatt/Arvind Gopu.
Introduction to Python for Biologists Lecture 3: Biopython This Lecture Stuart Brown Associate Professor NYU School of Medicine.
Doug Raiford Lesson 3.  More and more sequence data is being generated every day  Useless if not made available to other researchers.
Supporting High- Performance Data Processing on Flat-Files Xuan Zhang Gagan Agrawal Ohio State University.
13.1 בשבועות הקרובים יתקיים סקר ההוראה (באתר מידע אישי לתלמיד)באתר מידע אישי לתלמיד סקר הוראה.
Beginning BioPerl for Biologists MPI Ploen Jun Wang.
Adding GO GO Workshop 3-6 August GOanna results and GOanna2ga 2. gene association files 3. getting GO for your dataset 4. adding more GO (introduction)
12.1 Running Other Programs And CGI Scripts Please fill the teaching survey at: I read it closely, and I.
Assignment feedback Everyone is doing very well!
Clean up sequences with multiple >GI numbers when downloaded from NCBI BLAST website [ Example of one sequence and the duplication clean up for phylo tree.
EMBOSS over a Grid 1. 1st EELA Grid School December 4th of 2006 Eduardo MURRIETA LEON Romualdo ZAYAS-LAGUNAS Pierre-Alain BRANGER Jérôme VERLEYEN Roberto.
Parsing BLAST output. Output of a local BLAST search “less” program Full path to the BLAST output file.
BioPerl Ketan Mane SLIS, IU. BioPerl Perl and now BioPerl -- Why ??? Availability Advantages for Bioinformatics.
Primary vs. Secondary Databases Primary databases are repositories of “raw” data. These are also referred to as archival databases. -This is one of the.
O Log in to amazon biolinux O For mac users O ssh O For Windows users O use putty O Hostname public_dns_address O username ubuntu.
David Wishart February 18th, 2004 Lecture 3 BLAST (c) 2004 CGDN.
Sequence Search Abhishek Niroula Department of Experimental Medical Science Lund University
Introducing Bioperl Toward the Bioinformatics Perl programmer's nirvana.
Advanced Perl For Bioinformatics Part 1 2/23/06 1-4pm Module structure Module path Module export Object oriented programming Part 2 2/24/06 1-4pm Bioperl.
Lecture 6.11
MARC: Developing Bioinformatics Programs Alex Ropelewski PSC-NRBSC Bienvenido Vélez UPR Mayaguez Essential BioPython Manipulating Sequences with Seq 1.
PROTEIN IDENTIFIER IAN ROBERTS JOSEPH INFANTI NICOLE FERRARO.
Biol Practical Biocomputing1 BioPerl General capabilities (packages) Sequences ○ fetching, reading, writing, reformatting, annotating, groups.
MARC: Developing Bioinformatics Programs Alex Ropelewski PSC-NRBSC Bienvenido Vélez UPR Mayaguez Essential BioPython: Overview 1.
Modules and BioPerl.
Using Local Tools: BLAST
EMBL-EBI, programmatically - take a REST from manual searching: Sequence analysis tools Web Production Team Anna Foix Joon Lee.
BioPython Download & Installation Documentation
Data Mining with BioMart
Bioinformatics for Research
Bioinformatics Data and the Grid: The GeneGrid Data Manager
BioPython Download & Installation Documentation
Modification of the bioperl script for parsing BLAST output
Comparative Genomics.
Genes to Trees Daniel Ayres and Adam Bazinet
Basic Local Alignment Search Tool (BLAST)
Using Local Tools: BLAST
Multiple sequence alignment & Phylogenetics Analysis
Using Local Tools: BLAST
Welcome - webinar instructions
Presentation transcript:

12.1

12.2 The BioPerl project is an international association of developers of open source Perl tools for bioinformatics, genomics and life science research. Things you can do with BioPerl: Read and write sequence files of different format, including: Fasta, GenBank, EMBL, SwissProt and more… Extract gene annotation from GenBank, EMBL, SwissProt files Read and analyse BLAST results. Read and process phylogenetic trees and multiple sequence alignments. Analysing SNP data. And more… BioPerl

12.3 BioPerl modules are called Bio::XXX You can use the BioPerl wiki: with documentation and examples for how to use them – which is the best way to learn this. We recommend beginning with the "How-tos": To a more in depth inspection of BioPerl modules: BioPerl

12.4 The Bio::SeqIO module allows input/output of sequences from/to files, in many formats: use Bio::SeqIO; $in = new Bio::SeqIO("-file" => " "EMBL"); $out = new Bio::SeqIO("-file" => ">seq2.fasta", "-format" => "Fasta"); while ( my $seqObj = $in->next_seq() ) { $out->write_seq($seqObj); } A list of all the sequence formats BioPerl can read is in: BioPerl: the SeqIO module

12.5 use Bio::SeqIO; $in = new Bio::SeqIO("-file" => "<seq.fasta", "-format" => "Fasta"); while ( my $seqObj = $in->next_seq() ) { print "ID:".$seqObj->id()."\n"; #1st word in header print "Desc:".$seqObj->desc()."\n"; #rest of header print "Length:".$seqObj->length()."\n";#seq length print "Sequence: ".$seqObj->seq()."\n"; #seq string } The Bio::SeqIO function “ next_seq ” returns an object of the Bio::Seq module. This module provides functions like id() (returns the first word in the header line before the first space), desc() (the rest of the header line), length() and seq() (return sequence length). You can read more about it in: BioPerl: the Seq module

12.6 The Bio::Seq can read and parse the adenovirus genome file for us: BioPerl: Parsing a GenBank file gene /gene="NDP" /note="ND" /db_xref="LocusID:4693" /db_xref="MIM:310600" CDS /gene="NDP" /note="Norrie disease (norrin)" /codon_start=1 /product="Norrie disease protein" /protein_id="NP_ " /db_xref="GI: " /db_xref="LocusID:4693" /db_xref="MIM:310600" /translation="MRKHVLAASFSMLSLL SHPLYKCSSKMVLLARCEGHCSQAS PLVSFSTVLKQPFRSSCHCCRPQTS LTATYRYILSCHCEEC " primary tag: gene tag: gene value: NDP tag: note value: ND tag: db_xref value: LocusID:4693 value: MIM: primary tag: CDS tag: gene value: NDP tag: note value: Norrie disease (norrin)......

12.7 The Bio::Seq can read the adenovirus genome file for us: use Bio::SeqIO; $in = new Bio::SeqIO("-file" => $inputfilename, "-format" => "GenBank"); my $seqObj = $in->next_seq(); foreach my $featObj ($seqObj->get_SeqFeatures) { print "primary tag: ", $featObj->primary_tag, "\n"; foreach my $tag ($featObj->get_all_tags) { print " tag: ", $tag, "\n"; foreach my $value ($featObj->get_tag_values($tag)) { print " value: ", $value, "\n"; } } } BioPerl: Parsing a GenBank file primary tag: gene tag: gene value: NDP tag: note value: ND tag: db_xref value: LocusID:4693 value: MIM: primary tag: CDS

12.8 The Bio::DB::Genbank module allows us to download a specific record from the NCBI website: use Bio::DB::GenBank; $gb = new Bio::DB::GenBank; $seqObj = $gb->get_Seq_by_acc("J00522"); # or... request Fasta sequence $gb = new Bio::DB::GenBank("-format" => "Fasta"); BioPerl: downloading files from the web

12.9 First we need to have the BLAST results in a text file BioPerl can read. Here is one way to achieve this: BioPerl: reading BLAST output Text Download

12.10 BioPerl: reading BLAST output

12.11 BioPerl: reading BLAST output

12.12 The Bio::SearchIO module can read and parse BLAST output: use Bio::SearchIO; my $blast_report = new Bio::SearchIO ("-format" => "blast", "-file" => "mice.blast"); while (my $result = $blast_report-> next_result ) { print "Checking query ", $result-> query_name, "\n"; while (my $hit = $result-> next_hit ()) { print "Checking hit ", $hit->name(), "\n"; my $hsp = $hit-> next_hsp (); print $hsp-> hit->start ()... $hsp-> hit->end ()... } } (See the blast example in lesson 1) BioPerl: reading BLAST output