CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B cell epitopes and predictions Pernille Haste Andersen, Ph.d. student Immunological.

Slides:



Advertisements
Similar presentations
CENTER FOR BIOLOGICAL SEQUENCE ANALYSIS Technical University of Denmark - DTU Department of systems biology B cell epitopes and predictions.
Advertisements

Prediction of B cell epitopes Pernille Haste Andersen Immunological Bioinformatics CBS, DTU
Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B cell epitopes and predictions Pernille Haste Andersen, Ph.d. student Immunological.
1 Protein Structure, Structure Classification and Prediction Bioinformatics X3 January 2005 P. Johansson, D. Madsen Dept.of Cell & Molecular Biology, Uppsala.
Antibody responses to linear and conformational epitopes Biosys course, Pernille Andersen.
© Wiley Publishing All Rights Reserved. Analyzing Protein Sequences.
Structural bioinformatics
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modeling Anne Mølgaard, CBS, BioCentrum, DTU.
An Introduction to Bioinformatics Protein Structure Prediction.
Structure Prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray crystallography, NMR) [2]
Thomas Blicher Center for Biological Sequence Analysis
Protein Primer. Outline n Protein representations n Structure of Proteins Structure of Proteins –Primary: amino acid sequence –Secondary:  -helices &
1 Protein Structure Prediction Reporter: Chia-Chang Wang Date: April 1, 2005.
Prediction of B cell epitopes Ole Lund. Outline What is a B-cell epitope? How can you predict B-cell epitopes?
Protein structure determination & prediction. Tertiary protein structure: protein folding Three main approaches: [1] experimental determination (X-ray.
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Homology Modelling Thomas Blicher Center for Biological Sequence Analysis.
CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B cell epitopes and B cell epitope predictions Morten Nielsen, CBS, BioCentrum,
Protein Structure Prediction Samantha Chui Oct. 26, 2004.
LSM2104/CZ2251 Essential Bioinformatics and Biocomputing Essential Bioinformatics and Biocomputing Protein Structure and Visualization (3) Chen Yu Zong.
Computational Structure Prediction Kevin Drew BCH364C/391L Systems Biology/Bioinformatics 2/12/15.
Protein Tertiary Structure Prediction
BINF6201/8201 Principle components analysis (PCA) -- Visualization of amino acids using their physico-chemical properties
BIOC3010: Bioinformatics - Revision lecture Dr. Andrew C.R. Martin
Methods MHC class-I T cell epitope prediction for Nef Consensus and ancestral sequences of the Nef protein for the different HIV-1 subtypes were obtained.
Practical session 2b Introduction to 3D Modelling and threading 9:30am-10:00am 3D modeling and threading 10:00am-10:30am Analysis of mutations in MYH6.
CRB Journal Club February 13, 2006 Jenny Gu. Selected for a Reason Residues selected by evolution for a reason, but conservation is not distinguished.
 Four levels of protein structure  Linear  Sub-Structure  3D Structure  Complex Structure.
Protein Structure Modelling Many sequences - few structures Homology Modelling - Based on Sequence Similarity with Sequences of Known Structures.
Protein Classification II CISC889: Bioinformatics Gang Situ 04/11/2002 Parts of this lecture borrowed from lecture given by Dr. Altman.
110/30/2015 Antigens Antigens Hugh B. Fackrell 210/30/2015 ä Assigned Reading ä Content Outline ä Performance Objectives ä Key terms ä Key Concepts ä.
Protein Structure & Modeling Biology 224 Instructor: Tom Peavy Nov 18 & 23, 2009
Structural Bioinformatics Section Vaccine Research Center/NIAID/NIH
Protein secondary structure Prediction Why 2 nd Structure prediction? The problem Seq: RPLQGLVLDTQLYGFPGAFDDWERFMRE Pred:CCCCCHHHHHCCCCEEEECCHHHHHHCC.
Applied Bioinformatics Week 12. Bioinformatics & Functional Proteomics How to classify proteins into functional classes? How to compare one proteome with.
1 Web Site: Dr. G P S Raghava, Head Bioinformatics Centre Institute of Microbial Technology, Chandigarh, India Prediction.
Protein Modeling Protein Structure Prediction. 3D Protein Structure ALA CαCα LEU CαCαCαCαCαCαCαCα PRO VALVAL ARG …… ??? backbone sidechain.
Introduction to Protein Structure Prediction BMI/CS 576 Colin Dewey Fall 2008.
Antigen and Antigenicity Antigen and Antigenicity
Recurring conformation of the human immunodeficiency virus type 1 gp120 V3 loop Robyn L. Stanfield, Jayant B. Ghiara, Erica O. Saphire, Albert T. Profy,
MICR 304 Immunology & Serology Lecture 7B Antibodies Part I Chapter 3.1 – 3.9 Lecture 7B Antibodies Part I Chapter 3.1 – 3.9.
Immunoglobulin: Ab-Ag Interactions Lecture 10 20/10/2015.
Protein Folding & Biospectroscopy Lecture 6 F14PFB David Robinson.
Analyzing Differences in Protein Sequences Between Subjects with Varying T Cell Counts J’aime Moehlman Amanda Wavrin Loyola Marymount University March.
Protein Properties Function, structure Residue features Targeting Post-trans modifications BIO520 BioinformaticsJim Lund Reading: Chapter , 11.7,
B cell epitopes and predictions
October 5, IMMUNITY ADAPTIVEINNATE CELL MEDIATEDHUMORAL.
Epitopes: Lymphocytes recog. specific sites on molecules  Ag determinant/epitope With some Ag, B cells recog 1 part; T cells another The recognition process.
Protein Structure and Bioinformatics. Chapter 2 What is protein structure? What are proteins made of? What forces determines protein structure? What is.
Bioinformatics in Vaccine Design
Structural classification of Proteins SCOP Classification: consists of a database Family Evolutionarily related with a significant sequence identity Superfamily.
Janeway’s Immunobiology
Computational Structure Prediction
Intracellular Pathogens Extracellular Pathogens
Molecular Docking Profacgen. The interactions between proteins and other molecules play important roles in various biological processes, including gene.
Protein dynamics Folding/unfolding dynamics
Ligand Docking to MHC Class I Molecules
Protein Structure Prediction
Dual conformations for the HIV-1 gp120 V3 loop in complexes with different neutralizing Fabs RL Stanfield, E Cabezas, AC Satterthwait, EA Stura, AT Profy,
The Rational Design of an AIDS Vaccine
Protein structure prediction.
Loyola Marymount University
Loyola Marymount University
Nicki Harmon, Samantha Hurndon, & Zeb Russo
Volume 22, Issue 2, Pages (February 2005)
Mr.Halavath Ramesh 16-MCH-001 Dept. of Chemistry Loyola College University of Madras-Chennai.
Mr.Halavath Ramesh 16-MCH-001 Dept. of Chemistry Loyola College University of Madras-Chennai.
Mr.Halavath Ramesh 16-MCH-001 Dept. of Chemistry Loyola College University of Madras-Chennai.
Mr.Halavath Ramesh 16-MCH-001 Dept. of Chemistry Loyola College University of Madras-Chennai.
Presentation transcript:

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B cell epitopes and predictions Pernille Haste Andersen, Ph.d. student Immunological Bioinformatics CBS, DTU

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Outline What is a B-cell epitope? How can you predict B-cell epitopes? B-cell epitopes in rational vaccine design. –Case story: Using B-cell epitopes in rational vaccine design against HIV.

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU What is a B-cell epitope? B-cell epitopes Accessible structural feature of a pathogen molecule. Antibodies are developed to bind the epitope specifically using the complementary determining regions (CDRs). Antibody Fab fragment

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU The binding interactions  Salt bridges  Hydrogen bonds  Hydrophobic interactions  Van der Waals forces Binding strength

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B-cell epitopes are dynamic  Many of the charged groups and hydrogen bonding partners are present on highly flexible amino acid side chains.  Most crystal structures of epitopes and antibodies in free and complexed forms have shown conformational rearrangements upon binding.  “Induced fit” model of interactions.

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B-cell epitope classification Linear epitopes One segment of the amino acid chain Discontinuous epitope (with linear determinant) Discontinuous epitope Several small segments brought into proximity by the protein fold B-cell epitope – structural feature of a molecule or pathogen, accessible and recognizable by B-cells

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Binding of a discontinuous epitope Guinea Fowl Lysozyme KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQNRNTDGS DYGVLNSRWWCNDGRTPGSRNLCNIPCSALQSSDITATANCAKKIVSDG GMNAWVAWRKCKGTDVRVWIKGCRL Antibody FAB fragment complexed with Guinea Fowl Lysozyme (1FBI). Black: Light chain, Blue: Heavy chain, Yellow: Residues with atoms distanced < 5Å from FAB antibody fragments.

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B-cell epitope annotation Linear epitopes: –Chop sequence into small pieces and measure binding to antibody Discontinuous epitopes: –Measure binding of whole protein to antibody The best annotation method : X-ray crystal structure of the antibody-epitope complex

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B-cell epitope data bases Databases: AntiJen, IEDB, BciPep, Los Alamos HIV database, Protein Data Bank Large amount of data available for linear epitopes Few data available for discontinuous

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU B cell epitope prediction

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Sequence-based methods for prediction of linear epitopes  Protein hydrophobicity – hydrophilicity algorithms Parker, Fauchere, Janin, Kyte and Doolittle, Manavalan Sweet and Eisenberg, Goldman, Engelman and Steitz (GES), von Heijne  Protein flexibility prediction algorithm Karplus and Schulz  Protein secondary structure prediction algorithms GOR II method (Garnier and Robson), Chou and Fasman, Pellequer  Protein “antigenicity” prediction : Hopp and Woods, Welling TSQDLSVFPLASCCKDNIASTSVTLGCLVTG YLPMSTTVTWDTGSLNKNVTTFPTTFHETY GLHSIVSQVTASGKWAKQRFTCSVAHAES TAINKTFSACALNFIPPTVKLFHSSCNPVGD THTTIQLLCLISGYVPGDMEVIWLVDGQKA TNIFPYTAPGTKEGNVTSTHSELNITQGEW VSQKTYTCQVTYQGFTFKDEARKCSESDPR GVTSYLSPPSPL

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Propensity scales: The principle The Parker hydrophilicity scale Derived from experimental data D2.46 E1.86 N1.64 S1.50 Q1.37 G1.28 K1.26 T1.15 R0.87 P0.30 H0.30 C0.11 A0.03 Y-0.78 V-1.27 M-1.41 I-2.45 F-2.78 L-2.87 W-3.00 Hydrophilicity

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Propensity scales: The principle ….LISTFVDEKRPGSDIVEDLILKDENKTTVI…. ( )/7 = 0.39 Prediction scores: Epitope

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Evaluation of performance A Receiver Operator Curve (ROC) is useful for finding a good threshold and rank methods

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Turn prediction and B-cell epitopes Pellequer found that 50% of the epitopes in a data set of 11 proteins were located in turns Turn propensity scales for each position in the turn were used for epitope prediction. Pellequer et al., Immunology letters,

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Blythe and Flower 2005 Extensive evaluation of propensity scales for epitope prediction Conclusion: –Basically all the classical scales perform close to random! –Other methods must be used for epitope prediction

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU BepiPred: CBS in-house tool Parker hydrophilicity scale Hidden Markow model Markow model based on linear epitopes extracted from the AntiJen database Combination of the Parker prediction scores and Markow model leads to prediction score Tested on the Pellequer dataset and epitopes in the HIV Los Alamos database

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Hidden Markow Model A C D ………… G S T V W Pos Pos Pos Pos Pos ….LISTFVDEKRPGSDIVEDLILKDENKTTVI… = 6.75 Prediction value

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU ROC evaluation Evaluation on HIV Los Alamos data set

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU BepiPred performance Pellequer data set: –LevittAROC = 0.66 –ParkerAROC = 0.65 –BepiPredAROC = 0.68 HIV Los Alamos data set –LevittAROC = 0.57 –ParkerAROC = 0.59 –BepiPredAROC = 0.60

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU BepiPred BepiPred conclusion: –On both of the evaluation data sets, Bepipred was shown to perform better –Still the AROC value is low compared to T-cell epitope prediction tools! –Bepipred is available as a webserver:

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Prediction of linear epitopes Con only ~10% of epitopes can be classified as “linear” weakly immunogenic in most cases most epitope peptides do not provide antigen- neutralizing immunity in many cases represent hypervariable regions Pro easily predicted computationally easily identified experimentally immunodominant epitopes in many cases do not need 3D structural information easy to produce and check binding activity experimentally

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Sequence based prediction methods  Linear methods for prediction of B cell epitopes have low performances  The problem is analogous to the problems of representing the surface of the earth on a two-dimensional map  Reduction of the dimensions leads to distortions of scales, directions, distances  The world of B-cell epitopes is 3 dimensional and therefore more sophisticated methods must be developed Regenmortel 1996, Meth. of Enzym. 9.

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU So what is more sophisticated? Use of the three dimensional structure of the pathogen protein Analyze the structure to find surface exposed regions Additional use of information about conformational changes, glycosylation and trans-membrane helices

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU How can we get information about the three-dimensional structure? Structural determination X-ray crystallography NMR spectroscopy Both methods are time consuming and not easily done in a larger scale Structure prediction Homology modeling Fold recognition Less time consuming, but there is a possibility of incorrect predictions, specially in loop regions

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Protein structure prediction methods Homology/comparative modeling >25% sequence identity (seq 2 seq alignment) Fold-recognition/threading <25% sequence identity (Psi-blast search/ seq2str alignment) Ab initio structure prediction 0% sequence identity

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Annotation of protein surface Look at the surface of your protein Analyse for turns and loops Analyse for amino acid composition Find exposed Bepipred epitopes

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Q: What can antibodies recognize in a protein? A: Everything accessible to a 10 Å probe on a protein surface Novotny J. A static accessibility model of protein antigenicity. Int Rev Immunol 1987 Jul;2(4): probe Antibody Fab fragment Protrusion index

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Use the CEP server Conformational epitope server bin/cep.pl Uses protein structure as input Finds stretches in sequences which are surface exposed

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Use the DiscoTope server CBS server for prediction of discontinuous epitopes – Uses protein structure as input Combines propensity scale values of amino acids in discontinuous epitopes with surface exposure

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU

Malaria protein AMA1. Green: Predicted epitopes Black: Experimental epitopes

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Rational vaccine design >PATHOGEN PROTEIN KVFGRCELAAAMKRHGLDNYRG YSLGNWVCAAKFESNF Rational Vaccine Design

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Rational B-cell epitope design Protein target choice Structural analysis of antigen Known structure or homology model Precise domain structure Physical annotation (flexibility, electrostatics, hydrophobicity) Functional annotation (sequence variations, active sites, binding sites, glycosylation sites, etc.) Known 3D structure Model

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Rational B-cell epitope design Surface accessibility Protrusion index Conserved sequence Glycosylation status Protein target choice Structural annotation Epitope prediction and ranking

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Rational B-cell epitope design Protein target choice Structural annotation Epitope prediction and ranking Optimal Epitope presentation Fold minimization, or Design of structural mimics Choice of carrier (conjugates, DNA plasmids, virus like particles) Multiple chain protein engineering

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Multi-epitope protein design Rational optimization of epitope-VLP chimeric proteins: Design a library of possible linkers (<10 aa) Perform global energy optimization in VLP (virus-like particle) context Rank according to estimated energy strain B-cell epitope T-cell epitope

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Case story Using B-cell epitopes in the rational vaccine design against HIV The gp120-CD4 epitope

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU HIV gp120-CD4 epitope Binding of CD4 receptor Conformational changes in gp120 Opens chemokine- receptor binding site New highly conserved epitopes Kwong et al.(1998) Nature 393,

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Conformational changes in gp120 SIV gp120 no ligands Human gp120 complex with CD4 and 17b antibody Chen et al. Nature 2005 Kwong et al. Nature 1998

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU HIV gp120-CD4 epitope Elicit broadly cross- reactive neutralizing antibodies in rhesus macaques. This conjugate is too large(~400 aa) and still contains a number of irrelevant loops Fouts et al. (2000) Journal ofVirology, 74, Fouts et al. (2002) Proc Natl Acad Sci U S A. 99, Efforts to design a epitope fusion protein

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU HIV gp120-CD4 epitope reduce to minimal stable fold (iterative) find alternative scaffold to present epitope (miniprotein mimic) Martin & Vita, Current Prot. An Pept. Science, 1: Vita et al.(1999) PNAS 96: Further optimization of the epitope:

CENTER FOR BIOLOGICAL SEQUENCE ANALYSISTECHNICAL UNIVERSITY OF DENMARK DTU Conclusions Rational vaccines can be designed to induce strong and epitope-specific B-cell responses Selection of protective B-cell epitopes involves structural, functional and immunogenic analysis of the pathogenic proteins When you can: Use protein structure for prediction Structural modeling tools are helpful in prediction of epitopes, design of epitope mimics and optimal epitope presentation