1.Genes não Corinebacterineae Específicos de C. pseudotuberculosis e espécies próximas evolutivamente (Cd) Transferidos de outros clados.

Slides:

Advertisements

Similar presentations

20,000 GENES IN HUMAN GENOME; WHAT WOULD HAPPEN IF ALL THESE GENES WERE EXPRESSED IN EVERY CELL IN YOUR BODY? WHAT WOULD HAPPEN IF THEY WERE EXPRESSED.

Advertisements

Regulation of transcription in prokaryotes

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc. 04.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc

CHAPTER 15 Microbial Genomics Genomic Cloning Techniques Vectors for Genomic Cloning and Sequencing MS2, RNA virus nt sequenced in 1976 X17, ssDNA.

Mechanism of Transcription

Analyses of ORFans in microbial and viral genomes Journal club presentation on Mar. 14 Albert Yu.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc

Point Specific Alignment Methods

Review of important points from the NCBI lectures. –Example slides Review the two types of microarray platforms. –Spotted arrays –Affymetrix Specific examples.

The construction of cells DNA or RNA Protein Carbohydrates Lipid etc.

Bacteriophage Gene Functions Welkin Pope SEA-PHAGES In Silico Workshop, 2014.

Subsystem Approach to Genome Annotation National Microbial Pathogen Data Resource Claudia Reich NCSA, University of Illinois, Urbana.

Four novel Rhodococcus erythropolis phages were isolated from northeast Louisiana area soil samples. To date, Rhodoccocus phages Chewy VIII and Trina have.

TRANSCRIPTION : Prokaryote Eukaryote DNA : Template strand Coding strand.

Organization of the human genome Genome structure Nuclear vs. mitochondrial genomes Gene families Transposable elements Other repeated sequences.

Chapter 4 DNA and Chromosomes HIGHLIGHTS DNA Exact duplication of genetic material from generation to generation is crucial to continuity and survival.

Lab Reports. Wrapping up IMG-ACT Genome Annotation Online notebook should be completed for all 3 genes Final reports are comprised of the imgACT online.

Copyright © 2004 Pearson Education, Inc., publishing as Benjamin Cummings PowerPoint ® Lecture Slide Presentation prepared by Christine L. Case Microbiology.

Metagenome Analysis: a case study Analysis of a thermophilic terephthalate-degrading syntrophic community Thanos Lykidis.

Primary Metabolism. Microbial life strategies ~1 mm~3 cm Actinomycetes Cyanobacteria Filamentous Fungi E. coli Salmonella Streptococcus “Nomads”“Settlers”

DNA motifs potentially related to Regulating genes in Response to Nitrogen in Marine Cyanobacteria. Created By David Long VCU Biology Undergraduate June.

Gene regulation results in differential gene expression, leading to cell specialization.

Bd1337 Bd2969 (L16P) Bd3348 Bd0427 Bd0286 Bd0633 Bd3340 Bd2994 Bd0427 Bd0459 Bd3037 Bd3340 Bd0010 Bd0160.

Subsystem: Succinate dehydrogenase The super-macromolecular respiratory complex II (succinate:quinone oxidoreductase) couples the oxidation of succinate.

Protein and RNA Families

GEBA Project Summary Dongying Wu. Phylogenetic Tree Building (Martin Wu) Concatenate alignments of 31 marker genes build a PHYML tree 667 non-GEBA genomes,

MiRNAPredicted targetsPutative function of targets miRC1GRMZM2G029833_T01DNA binding / DNA-directed RNA polymerase miRC4 GRMZM2G171796_T01; GRMZM2G355906_T03;

Identification of Helix-Turn-Helix (HTH) DNA-Binding Motifs

Genome annotation and search for homologs. Genome of the week Discuss the diversity and features of selected microbial genomes. Link to the paper describing.

The end replication problem: -DNA polymerase requires an OH group to attach bases too -There is no OH group at the extreme 5’ end of the lagging strand.

The Prokaryotes 11a: Archaea & Gram Positives. Criteria for classification and identification of microorganisms morphology.

Annotation. Traditional genome annotation BLAST Similarities.

Bacteriophage Gene Functions Welkin Pope SEA-PHAGES Bioinformatics Workshop, 2015.

First selection: transformation Plating on plate with Km Cultivation in liquid medium with Km until the cells reach the stationary phase Second selection:

GO-Slim term Cluster frequency cytoplasm 1944 out of 2727 genes, 71.3% 70 out of 97 genes, 72.2% out of 72 genes, 86.1% out.

Complex mammalian gene control regions are also constructed from simple regulatory modules.

Group discussion Name this protein. Protein sequence, from Aedes aegypti automated annotation >25558.m01330 MIHVQQMQVSSPVSSADGFIGQLFRVILKRQGSPDKGLICKIPPLSAARREQFDASLMFE.

Bacillus Phage Annotation Phage Lab II, Spring 2015.

Intro to Probabilistic Models PSSMs Computational Genomics, Lecture 6b Partially based on slides by Metsada Pasmanik-Chor.

Virology 2015 RNA Virus RdRP Enzymes.

Suppl Table 1 Suppl.Tab.1. Homogeneity comparison of amino acid sequences of selective Bacterial gene products with the reserved TM1-H5-TM2 sequence of.

CCAGTTGCCGCGTTCACCCTCTCCTCATCCGCGGTTCACCGGCCTCGTTGAGACTGCCTG  SCO0033 GGCCGTCATTCCGACAGCACCCACGTCTCACTCCCCGTGCCCATGCGGGGACCGGGCGGC CCGGCAGTAAGGCTGTCGTGGGTGCAGAGTGAGGGGCACGGGTACGCCCCTGGCCCGCCG.

MYCOBACTERIUM TUBERCULOSIS PROTEOME M. tuberculosis- intracellular pathogen - TB prevalent in Africa and Asia - 1/3 population is infected - 8 million.

Subsystem: General secretory pathway (sec-SRP) complex (TC 3.A.5.1.1) Matthew Cohoon, Department of Computer Science, University of Chicago, Chicago, IL.

Chapter 27 Phage Strategies

Gene Regulation.

TABLE S6. List of 20E-inducible genes identified by microarray analysis and the 14　bp consensus motifs Number gene number maximum fold induction by 20E.

Tutorial 4 Substitution matrices and PSI-BLAST

S2 Supporting information: RT-qPCR experiment

Bacteriophage Gene Functions

RNA and protein synthesis

Organization of the human genome

Exam #1 is T 9/23 in class (bring cheat sheet).

Genome Annotation Continued

The Mimivirus Giant double stranded DNA virus Discovered in amoebas

CRISPR + CAS = Defensive or Immune System

محاضرة عامة التقنيات الحيوية (هندسة الجينات .. مبادئ وتطبيقات)

Hepatitis C virus infection

Genome organization and Bioinformatics

Organization of the human genome

Basic Molecular Genetic Mechanisms

RNA and protein synthesis

Genomic comparison of thermotolerance islands.

Genome of the week Bacillus subtilis Gram-positive soil bacterium

Basic Local Alignment Search Tool

Most mutations were nonsynonymous, especially at the nodes of new clades, with affected genes encoding regulatory functions, lipid metabolism, and envelope.

Welkin Pope SEA-PHAGES Bioinformatics Workshop, 2017

Adam T. McGeoch, Stephen D. Bell Cell

Presentation transcript:

1.Genes não Corinebacterineae Específicos de C. pseudotuberculosis e espécies próximas evolutivamente (Cd) Transferidos de outros clados

txid85007[Orgn] AND chromosome[Replicon Type] AND complete[PROP] AND reference[PROP] 110,052 seqs 26 genomes: Corynebacterium (7) Mycobacterium (17) Rhodococcus (1) Nocardia (1) tBLASTn CpCDS 317 NH-CpCDS tBLASTn Other txid NH-CpCDS RGMG tBLASTn UniprotKB + nr 30 CpCDS 26 distinct C. pseudotuberculosis: SMase D Serine protease precursor 280 “no hit”

YP_ putative CAAX amino terminal protease family protein COG1807 YP_ hypothetical protein ABC0212 NP_ regulatory protein (padR family) YP_ similar to superfamily I DNA and RNA helicases and helicase subunits YP_ conserved phage-associated protein YP_ conserved phage-associated protein YP_ hypothetical phage-associated protein YP_ PTS system, fructose-specific IIBC component YP_ protein of unknown function DUF181 YP_ hypothetical protein Strop_2434 YP_ Lantibiotic dehydratase domain protein YP_ hypothetical protein Strop_2432 ZP_ Secreted subtilisin-like peptidase YP_ CAAX amino terminal protease family protein NP_ nitrite reductase periplasmic cytochrome c552 YP_ putative cytochrome c nitrite reductase, small subunit NrfH XP_ viral A-type inclusion protein, putative COG gb|AAA serine proteinase precursor** YP_ hypothetical protein MUL_3536 COG ZP_ transcriptional antiterminator, BglG ZP_ nucleoside transporter YP_ similar to superfamily I DNA and RNA helicases and helicase subunits ZP_ transcriptional antiterminator, BglG ZP_ hypothetical protein ACTODO_01808 ZP_ hypothetical protein ACTODO_01815 ZP_ hypothetical protein ACTODO_01815 ZP_ hypothetical protein ACTODO_01815 ZP_ Secreted subtilisin-like peptidase ZP_ hypothetical protein XfasaDRAFT_1247 ZP_ hypothetical protein SpneT_ De onde eles vieram?

HitOccurence in other clades

Arthrobacter sp. Bacillus clausii KSM-K16 Clostridium tetani E88 Saccharopolyspora erythraea NRRL 2338 Propionibacterium acnes Exiguobacterium sp. Salinispora tropica CNB-440 Salinispora tropica CNB-441 Salinispora tropica CNB-442 Salinispora tropica CNB-443 Idiomarina baltica OS145 Bacillus cereus E33L Bdellovibrio bacteriovorus HD100 Myxococcus xanthus DK 1622 Trichomonas vaginalis G3 Enterococcus faecalis V583 Mycobacterium ulcerans Agy99 Thermosinus carboxydivorans Bacillus sp. NRRL B Saccharopolyspora erythraea NRRL 2338 Thermosinus carboxydivorans Actinomyces odontolyticus ATCC Idiomarina baltica OS145 Xylella fastidiosa Dixon Streptococcus pneumoniae Pular esse slide

2.Homologia com baixa similaridade Caso da SMase Matrizes PSSM para COG Matrizes para novos clusters Seed Linkage

(psi)tblastn PSSM 114, hits PSSM not BLOSUM tBLASTn nr 48 hits PSSM not “nr” COG No hit COG Ex: Cp-V COG0419 Cp-V COG1178 common 4 hits: Not Corinebacterineae COG annotated Tx85007 Clusters

Cp-Draft- V COG0697-Permeases of the drug/metabolite transporter (DMT) superfamilyNostoc sp. COG0697Cyanobacteria Cp-Draft- V COG0488- ATPase components of ABC transporters with duplicated ATPase domainsListeria COG0488Firmicutes Proteobacteria Cp-Draft- V COG1191- DNA-directed RNA polymerase specialized sigma subunitTreponema pallidum COG1191Spirochaetes Cp-Draft- V COG1994-Zn-dependent proteasesNostoc sp. COG1994Cyanobacteria From 280 putative exclusive Cp-CDS, four are found by search using the PSSM matrices, but are no-hits to nr, uniprot and cog: