Presentation is loading. Please wait.

Presentation is loading. Please wait.

A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was.

Published byBritney April Anderson Modified over 8 years ago

Similar presentations

Presentation on theme: "A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was."— Presentation transcript:

1 A B C D E F G H I J K FigS1

2 Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was inferred using the Neighbor-Joining method (Saitou and Nei, 1987). The optimal tree with the sum of branch length = 7.80811039 is shown. The evolutionary distances were computed using the Poisson correction method (Zuckerkandl and Pauling, 1965) and are in the units of the number of amino acid substitutions per site. The analysis involved 54 amino acid sequences. All positions containing gaps and missing data were eliminated. There were a total of 68 positions in the final dataset. Evolutionary analyses were conducted in MEGA5 (Tamura et al., 2011).

3 FigS2 Supplemental Figure S2. Genomic distribution of Aux/IAA genes on tomato chromosomes. The arrows next to gene names show the direction of transcription. The number in parentheses designates the position of the ATG of each Aux/IAA gene in megabases (Mb) on tomato chromosome pseudomolecules (Tomato Whole Genome Scaffolds data V2.4). The chromosome numbers are indicated at the top of each bar.

4 FigS3 B LxLxLx motifDLxLxLx motif A LxLxLxLxL motif

5 Supplemental Figure S3. Amino acid sequences for IAA proteins that contain an atypical domain I (A) Amino acid sequences for IAA proteins that contain an expanded repression domain I. Amino acid sequence comparison of tomato Sl-IAA11, Sl-IAA12 and Sl-IAA13 with those from Arabidopsis AtIAA10 (AT1G04100), AtIAA11 (AT4G28640), AtIAA12 (AT1G04550) and AtIAA13 (AT1G04550). The conserved LxLxLxLxLx motif is underlined. The sequences were aligned with Clustal X method and adjusted manually. (B) Amino acid sequences between conserved domains I and II for IAA proteins that contain a second LxLxL motif. Amino acid sequence comparison of tomato Sl-IAA7, Sl-IAA14, Sl-IAA16 and Sl-IAA17 with those from Arabidopsis AtIAA7 (AT3G23050), AtIAA14 (AT4G14550), AtIAA16 (AT3G04730) and AtIAA17 (AT1G04250). The conserved LxLxLx motif (Domain I) and the DLxLxL motif are underlined. The sequences were aligned with Clustal X method and adjusted manually.

Download ppt "A B C D E F G H I J K FigS1. Supplemental Figure S1. Evolutionary relationships of Arabidopsis and tomato Aux/IAA proteins. The evolutionary history was."

Similar presentations

Blast to Psi-Blast Blast makes use of Scoring Matrix derived from large number of proteins. What if you want to find homologs based upon a specific gene.

Blast to Psi-Blast Blast makes use of Scoring Matrix derived from large number of proteins. What if you want to find homologs based upon a specific gene.
1 Orthologs: Two genes, each from a different species, that descended from a single common ancestral gene Paralogs: Two or more genes, often thought of.

1 Orthologs: Two genes, each from a different species, that descended from a single common ancestral gene Paralogs: Two or more genes, often thought of.
Profiles for Sequences

Profiles for Sequences
Molecular Evolution Revised 29/12/06

Molecular Evolution Revised 29/12/06
HIDDEN MARKOV MODELS IN MULTIPLE ALIGNMENT. 2 HMM Architecture Markov Chains What is a Hidden Markov Model(HMM)? Components of HMM Problems of HMMs.

HIDDEN MARKOV MODELS IN MULTIPLE ALIGNMENT. 2 HMM Architecture Markov Chains What is a Hidden Markov Model(HMM)? Components of HMM Problems of HMMs.
Multiple alignment June 29, 2007 Learning objectives- Review sequence alignment answer and answer questions you may have. Understand how the E value may.

Multiple alignment June 29, 2007 Learning objectives- Review sequence alignment answer and answer questions you may have. Understand how the E value may.
TGCAAACTCAAACTCTTTTGTTGTTCTTACTGTATCATTGCCCAGAATAT TCTGCCTGTCTTTAGAGGCTAATACATTGATTAGTGAATTCCAATGGGCA GAATCGTGATGCATTAAAGAGATGCTAATATTTTCACTGCTCCTCAATTT.

TGCAAACTCAAACTCTTTTGTTGTTCTTACTGTATCATTGCCCAGAATAT TCTGCCTGTCTTTAGAGGCTAATACATTGATTAGTGAATTCCAATGGGCA GAATCGTGATGCATTAAAGAGATGCTAATATTTTCACTGCTCCTCAATTT.
Multiple Sequence Alignment May 12, 2009 Announcements Quiz #2 return (average 30) Hand in homework #7 Learning objectives-Understand ClustalW Homework#8-Due.

Multiple Sequence Alignment May 12, 2009 Announcements Quiz #2 return (average 30) Hand in homework #7 Learning objectives-Understand ClustalW Homework#8-Due.
Pollen transcript unigene identifier log 2 -fold change Annotation (BLAST) Unigene7226-11.1 L. longiflorum chloroplast, complete genome Unigene24307-10.1.

Pollen transcript unigene identifier log 2 -fold change Annotation (BLAST) Unigene L. longiflorum chloroplast, complete genome Unigene
Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.

Figure S1_Yao Qin et al. Figure S1 Occurrence and distribution of trihelix family in different plant species. Red branches in the cladogram indicate that.
Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.
Building phylogenetic trees. Contents Phylogeny Phylogenetic trees How to make a phylogenetic tree from pairwise distances  UPGMA method (+ an example)

Building phylogenetic trees. Contents Phylogeny Phylogenetic trees How to make a phylogenetic tree from pairwise distances  UPGMA method (+ an example)
Calculating branch lengths from distances. ABC A -----2040 B----- 44 C----- a b c.

Calculating branch lengths from distances. ABC A B C----- a b c.
PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.

PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1 PfDGAT1-2 AtDGAT1 RcDGAT1 PfDGAT1-1.
Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.

Multiple Alignment and Phylogenetic Trees Csc 487/687 Computing for Bioinformatics.
Figure S1 Evolutionary relationships of RBG subclasses in Arabidopsis (a) and B. rapa (b). Optimal neighbor-joining trees with sum of branch lengths =

Figure S1 Evolutionary relationships of RBG subclasses in Arabidopsis (a) and B. rapa (b). Optimal neighbor-joining trees with sum of branch lengths =
Figure S1 Figure S1. Effect of SA on spore germination of M. oryae. The data presented were the means (± standard error) of spore germination from three.

Figure S1 Figure S1. Effect of SA on spore germination of M. oryae. The data presented were the means (± standard error) of spore germination from three.
F B Allele group II E G U S V W Rec OS1 Substitution Rec OS2 Rec OS3 A B C Rec OS1 Rec OS2 Rec OS3 (-530 ~ -86) (-86 ~ +49) Fig. S1 Intragenic recombination.

F B Allele group II E G U S V W Rec OS1 Substitution Rec OS2 Rec OS3 A B C Rec OS1 Rec OS2 Rec OS3 (-530 ~ -86) (-86 ~ +49) Fig. S1 Intragenic recombination.
MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.

MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDLN-IP 109 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNRSQAHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDLI-IP.
Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

Figure 1 Myotubularin exhibits a tyrosine phosphatase activity

Similar presentations

Ads by Google