Download presentation
Published byShannon Dickerson Modified over 8 years ago
1
Design of synthetic-hybrid bacteriocins from enterocin E50-52 and pediocin PA-1 for therapeutic applications Santosh Kumar Tiwari, PhD Assistant Professor Department of Genetics Maharshi Dayanand University Rohtak , Haryana 6th World Congress on Biotechnology, October 05-07, 2015, New Delhi
2
Antibiotics Vs Resistance
3
World Health Organization (WHO) foreseen:
Almost one billion people will be infected with Mycobacterium tuberculosis between the years 2000 and 2020. About 35 million humans will die till 2020 as a result of tuberculosis in antibiotic-resistant form . Over 70% of bacterial pathogens that cause fatal infections are likely to be resistant to at least one of the drugs (Infectious Disease Society of America, IDSA). Several preventive measures have been taken to avoid the microbial resistance development, but still there is an urgent need for new antimicrobial agents and new strategies to overcome problematic resistant pathogens. Antimicrobial peptides (AMPs), particularly bacteriocins produced by bacteria, may be an important contributor in this context as they often have a relatively narrow killing spectrum (Nes et al. 2007).
5
Bacteriocins BACTIBASE dataset (version 2, July 2009) Ribosomally synthesized small peptides antimicrobial activity
6
Diversity Total bacteriocins :177
BACTIBASE dataset (version 2, July 2009) Total bacteriocins :177 Gram-positive bacteria : (113 from lactic acid bacteria) Gram-negative bacteria : 18 Archaea domain : 3
7
Therapeutic potential of bacteriocins
Thuricin CD isolated from Bacillus thuringiensis DPC6431, specifically eliminates Clostridium difficile without disrupting the beneficial microbial community (Rea et al. 2010). Nisin, mersacidin and lacticin 3147 can eradicate infections caused by Streptococcus pneumoniae, MRSA in mice, tooth diseases in dogs and bovine mastitis in dairy cows (Òkuda et al. 2013). Microcin J25 has been shown to drastically reduce Salmonella infection in a mouse model (Lopez et al. 2007). Fermenticin HV6b and nisin ZP inhibit wide range of pathogens, spermicidal and anticancerous activity as reported to induce apoptosis in cancerous cells (Kaur et al. 2013; Kamrajan et al. 2015).
8
Nisin: A bacteriocin produced by Lactococcus lactis
The residues in red have positive net charge, blue are hydrophobic. Dha, dehydroalanine; Dhb, dehydrobutyrine; Lan, lanthionine; Mla, methyllanthionine; S, thioether bridge NATURE REVIEWS | MICROBIOLOGY VOLUME 4 | JULY 2006 | 531
9
Mode of action of bacteriocins
10
Design and Synthesis of Hybrid Bacteriocins
Pediocin PA-1 TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA Enterocin E50-52
11
Design and Synthesis of Hybrid Bacteriocins
12
Methods for detection of antimicrobial activity
Spot assay plate method Producer strain Indicator strain Agar Well Diffusion Assay (AWDA) Percentage inhibition of indicator strain AU/ml OR MIC
13
Minimum Inhibitory Concentration (MIC)
Pediocin PA-1 (D) (B) (C) PE Enterocin E50-52 EP
14
Comparison of MIC of WT and hybrid bacteriocins
15
ATP Efflux Micrococcus luteus ATCC 10420
Control PA1 E50 EP PE Micrococcus luteus ATCC 10420 Salmonella enteritidis 20E1090 E. coli O157:H7
16
Dissipation of membrane potential
Micrococcus luteus ATCC 10420 Valinomycin Bacteriocin Nigericin Cells Glucose Time (s) DiSC3(5) Probe Fluorescence (au)
17
Dissipation of membrane potential
E. coli untreated DiSC3(5) Glucose Nigericin Vancomycin E. coli treated with lysozyme and EDTA EDTA only Time (s) Fluorescence (au) (au) E50-52 850 800 750 700 650 600 550 450 400 350 300 250 150 200 100 50 0.1 500 950 1000 900
18
Inhibition pattern of target bacteria by wildtype and hybrid bacteriocins
Control PA1 E50 EP PE Micrococcus luteus ATCC 10420 Salmonella enteritidis 20E1090 E. coli O157:H7
19
Tiwari et al. 2015. Applied and Environmental Microbiology 81: 1661-1667.
20
Bacteriocins in our laboratory
UGC CSIR Plantaricin LD1 Enterocin LD3 Halocin HA1, 3 Bacteriocins Pediocin LB44 Wisellicin LM85 DST ICMR Mode of Action Hybrid bacteriocins HTP screening Halocin HA3 DBT IUSSTF
21
Research Group MSc Dissertation Aabha Komal Gitika Anu Gita Parul
Nidhi Karishma Monica Nandita, Jyoti Ritu Bhawana Sonia Pooja Naveen PhD completed Aabha PhD completed Ramanjeet PhD Student Vijay PhD Student Manoj Project Fellow Poonam Project Fellow
22
Acknowledgements ICMR CSIR Prof. Sheela Srivastav
Department of Genetics University of Delhi South Campus, New Delhi Prof. Michael L. Chikindas School of Environmental and Biological Sciences Rutgers State University, New Jersey ICMR CSIR
23
Felicitated for Indo-US Research Fellow by IUSSTF, New Delhi.
Similar presentations
© 2024 SlidePlayer.com Inc.
All rights reserved.