1. NCBI FieldGuide September 29, 2004 ICGEB NCBI Molecular Biology Resources A Field Guide part 1

2. NCBI FieldGuide Types of Databases Primary Databases –Original submissions by experimentalists –Database staff review and may organize the data, but we don’t add/modify additional information –Records are “owned” and updated by their authors Examples: GenBank, SNP, GEO Derivative Databases –Human-curated (compilation and correction of data)  Examples: Gene(LocusLink), Structure & Literature databases –Computationally-Derived  Example: UniGene –Combination  Examples: RefSeq, Genome Assembly, Domain databases

3. NCBI FieldGuide NCBI’s Derivative Sequence Database genomes transcriptsproteins GenBank

4. NCBI FieldGuide –Forming the “best representative” sequence –Standardizing nomenclature and record structure –Adding annotation (references, sequence features) RELEASE 6 IS NOW AVAILABLE ON THE FTP SITE!

5. NCBI FieldGuide Curated genomic DNA (NC, NT, NW) Curated Model mRNA (XM) (XR) Curated mRNA (NM) (NR) Model protein (XP) RefSeq Curation Processes Protein (NP) Scanning....

6. NCBI FieldGuide LOCUS NC_000913 4639221 bp DNA circular BCT 30-JUL-2003 DEFINITION Escherichia coli K12, complete genome. ACCESSION NC_000913 VERSION NC_000913.1 GI:16127994 KEYWORDS. SOURCE Escherichia coli K12. ORGANISM Escherichia coli K12 Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 4639221) AUTHORS Blattner,F.R., Plunkett,G. III, Bloch, C.A., Perna, N.T., Burland,V., Riley,M., Collado-Vides,J., Glasner,J.D., Rode, C.K., Mayhew,G.F., Gregor,J., Davis,N.W., Kirkpatrick,H.A., Goeden,M.A., Rose,D.J., Mau,R. and Shao,Y. TITLE The complete genome sequence of Esherichia coli K12. JOURNAL Science 277 (5331), 1453-1474 (1997) MEDLINE 97426617 PUBMED 9278503 REFERENCE 2 (bases 1 to 4639221) AUTHORS Blattner,F.R. TITLE Direct submission JOURNAL Sumbitted (16-JAN-1997) Guy Plunkett III, Laboratory of Genetics, University of Wisconsin, 445 Henry Mall, Madison, WI 53706, USA. E-mail ecoli@genetics.wisc.edu Phone: 608-262-2543 Fax: RefSeq Chromosomes: NC_ gene 3954631..3956478 /gene="mutL" /locus_tag="b4170" /note="synonym: mut-25" CDS 3954631..3956478 /gene="mutL" /locus_tag="b4170" /function="methyl-directed mismatch repair" /codon_start=1 /transl_table=1111 /product="MutL" /protein_id="NP_418591.1"NP_418591.1 /db_xref="GI:16131992" /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI DIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASI SSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKF LRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGT AFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQAC EDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQL ETPLPLDDEPQPAPRSIPENRVAAGRNHFAEPAAREPVAPRYTPAPASGSRPAAPWPN AQPGYQKQQGEVYRQLLQTPAPMQKLKAPEPQEPALAANSQSFGRVLTIVHSDCALLE RDGNISLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSALEKAQSALA ELGIDFQSDAQHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIARNLM SEHAQWSMAQAITLLADVERLCPQLVKTPPGGLLQSVDLHPAIKALKDE" Annotation of Gene, CDS, and other features BASE COUNT 978672 a1011074 c 997153 g 974742 t ORIGIN 1 cgtcttcatt gtcagacagc agaatttgta cgcgctgttc ggcttgttgt aatttggcct 61 gcccctgacg tgccagctgc acgccgcgtt cgaactcgtt cagcgcctct tccagcggca 121 ggtcgccact ttccagacgg gttacaatct gttccagctc gctcagcgcc ttttcaaagc 181 tggcgggcgc ctcatttttc ttcggcataa tgaatgtctg actctcaata tttttcgccc 241 cgtcatggta acggactcag ggcaaatagc aaataacgcg caatggtaag gtgatgtgca 301 cagcaaagcg atgttagtgg tatacttccg cgcctggatg cagccgcagg tgtgggctgc 361 tgtatttttc cctatacaag tcgcttaagg cttgccaacg aaccattgcc gccatgaagt 421 ttatcattaa attgttcccg gaaatcacca tcaaaagcca atctgtgcgc ttgcgcttta 481 taaaaatcct taccgggaac attcgtaacg ttttaaagca ctatgatgag acgctcgctg 541 tcgtccgcca ctgggataac atcgaagttc gcgcaaaaga tgaaaaccag cgtctggcta 601 ttcgcgacgc tctgacccgt attccgggta tccaccatat tctcgaagtc gaagacgtgc 661 cgtttaccga catgcacgat attttcgaga aagcgttggt tcagtatcgc gatcagctgg 721 aaggcaaaac cttctgcgta cgcgtgaagc gccgtggcaa acatgatttt agctcgattg 781 atgtggaacg ttacgtcggc ggcggtttaa atcagcatat tgaatccgcg cgcgtgaagc 841 tgaccaatcc ggatgtgact gtccatctgg aagtggaaga cgatcgtctc ctgctgatta 901 aaggccgcta cgaaggtatt ggcggtttcc cgatcggcac ccaggaagat gtgctgtcgc 961 tcatttccgg tggtttcgac tccggtgttt ccagttatat gttgatgcgt cgcggctgcc Genome sequence

7. NCBI FieldGuide Non-redundant Explicitly linked nucleotide and protein sequences Updated to reflect current sequence data and biology Validated by hand Format consistency Distinct accession series Stewardship by NCBI staff and collaborators ftp://ftp.ncbi.nih.gov/refseq/release RefSeq: NCBI’s Derivative Sequence Database RefSeq Benefits

8. NCBI FieldGuide Genes: The Gene Summary Database Summary pages of curated information about genetic loci for organisms in the RefSeq project. ►Graphics ►Gene information ►Bibliography (PubMed links) ►General gene information ►NCBI Reference Sequences ►Related sequences ►Additional Links Announcing!

9. NCBI FieldGuide Entrez Gene

10. NCBI FieldGuide

11. NM/NP Records in Entrez Gene

12. NCBI FieldGuide UniGene Records are clusters of mRNAs and ESTs that ideally represent single genes Records are created automatically by a modified BLAST algorithm UniGene provides a means to identify an EST or unannotated mRNA Clustering Expressed Sequences

13. NCBI FieldGuide A Cluster of ESTs: Arabidopsis serine protease query 5’ EST hits 3’ EST hits Sequence & Expression

14. NCBI FieldGuide Embryophyta Cycadopsida Pinus taeda (loblolly pine) Bryopsida Physcomitrella patens Eudicotyledons Arabidopsis thaliana (thale cress) Glycine max (soybean) Helianthus annus (sunflower) Lactuca sativa (lettuce) Lotus corniculatus (lotus flower) Lycopersicon esculentum (tomato) Malus x domestica (apple) Medicago truncatula (barrel medic) Populus tremula/tremuloides (poplar) Solanum tuberosum (potato) Vitis vinifera (wine grape) Liliopsida Hordeum vulagre (barley) Oryza sativa (rice) Saccharum officinarum (noble cane) Sorghum bicolor (sorghum) Triticum aestivum (bread wheat) Zea mays (corn) UniGene Collections As of July 2004 Chordata Mammalia Bos taurus (cow) Canis familiaris (dog) Homo sapiens (human) Mus musculus (mouse) Ovis aries (sheep) Rattus norvegicus (rat) Sus scrofa (pig) Aves Gallus gallus (chicken) Amphibia Xenopus laevis (african clawed frog) Xenopus tropicalis (western clawed frog) Actinopterygii Danio rerio (zebra fish) Oncorhynchus mykiss (rainbow trout) Oryzias Latipes (japanese rice fish) Salmo salar (salmon) Ascidiacea Ciona intestinalis (sea squirt) Arthropoda Insecta Anopheles gambiae (malaria mosquito) Apis mellifera (honeybee) Drosophila melanogaster (fruit fly) Bombyx mori (silkworm) Mycetozoa Dictyosteliida Dictyostedlium discoideum (slime mold) Echinodermata Echinoidea Strongylocentrotus purpuratus Nematoda Chromadorea Caenorhabditis elegans Platyhelminthes Trematoda Schistosoma mansoni Chlorophyta Chlorophycaea Chlamydomonas reinhardii Apicomplexa Coccidia Toxoplasma gondii

15. NCBI FieldGuide Finding UniGene Clusters by link by Entrez search

16. NCBI FieldGuide UniGene Cluster for PRNP

17. NCBI FieldGuide Complete Genomes as of June 2004 Organelles: – Mitochondria (558) – Plastids (40) – Plasmids (626) – Nucleomorphs (3) Viruses (1923) Archaebacteria (44) Eubacteria (176) Eukaryotes (61)

18. NCBI FieldGuide Simple Genomes Full chromosomal sequences are provided Genes are annotated The annotation can be shown graphically and linked to sequence records

19. NCBI FieldGuide

20. mutL

21. Complex Genomes Sequences are provided complete or we help assemble Heavy annotation: Genes, transcript regions & ORFs, sequence variations & markers, clones, ESTs, etc. MapViewerThe annotation can be shown graphically and linked to other databases using the MapViewer

22. NCBI FieldGuide Viewing Complex Genomes Map Viewer Home Page Shows all supported organisms Provides links to genomic BLAST –Genome Overview Page Provides links to individual chromosomes Shows hits on a genome graphically –Chromosome Viewing Page Allows interactive views of annotation details Provides numerous maps unique to each genome NCBI Map Viewer

23. NCBI FieldGuide Map Viewer Home Page

24. NCBI FieldGuide Genome Overview Page Genomic BLAST Species-specific help! Search the maps

25. NCBI FieldGuide PRNP Search For Human PRNP

26. NCBI FieldGuide Human PRNP on Genome View

27. NCBI FieldGuide Chromosome Viewing Page Master Map with exploded content Genes UniGene Clone Add or remove maps Zooming Controls Map Summary

28. NCBI FieldGuide Zooming in… Left click

29. NCBI FieldGuide Map Viewer Analysis Tools Link to OMIM Link to Protein Evidence Viewer Homologene Sequence Viewer Download Sequence ModelMaker Homologene

30. NCBI FieldGuide Homologene

31. NCBI FieldGuide Homology Comparisons on Map Viewer

32. NCBI FieldGuide Intermission