Presentation is loading. Please wait.

Presentation is loading. Please wait.

Artistic value in scientific results, a means for science communication creative kings 10-mar-2009

Similar presentations


Presentation on theme: "Artistic value in scientific results, a means for science communication creative kings 10-mar-2009"— Presentation transcript:

1 artistic value in scientific results, a means for science communication creative kings 10-mar-2009 http://www.kcl.ac.uk/schools/pse/bioinform/ christos.ouzounis@kcl.ac.uk

2 2 structure BIOLOGY & BIOINFORMATICS visualization & interpretation of scientific results who are we, the centre for bioinformatics a crash course in biology a movie: the inner life of a cell CREATIVITY IN SCIENCE creativity, definitions importance of creativity, co-occurrence of terms artists on science, scientists on art science communication, good examples ARTISTIC VALUE IN SCIENTIFIC RESULTS importance of science? neurobiology of perception genome evolution, a case study the importance of scales, and the media

3 3 structure BIOLOGY & BIOINFORMATICS visualization & interpretation of scientific results who are we, the centre for bioinformatics a crash course in biology a movie: the inner life of a cell CREATIVITY IN SCIENCE creativity, definitions importance of creativity, co-occurrence of terms artists on science, scientists on art science communication, good examples ARTISTIC VALUE IN SCIENTIFIC RESULTS importance of science? neurobiology of perception genome evolution, a case study the importance of scales, and the media

4 4 The storage, analysis and distribution of biological information, usually at the molecular but also at the supra- molecular levels of organization A dirty word: more traditionally… sequence analysis structure prediction molecular evolution and more to the definition… data engineering [storage] computational biology [analysis] network services [distribution] Overlaps with… all the way from theoretical biology… …to medical informatics and any other -matics or -omics driving force behind genomics what is bioinformatics?

5 5 kcbi kings college london centre for bioinformatics structural genomics fraternali functional genomics blanc statistical genetics schlitt systems biology tsoka comparative genomics ouzounis http://www.kcl.ac.uk/schools/pse/bioinform/

6 6 School of Physical Sciences and Engineering Professor Christos Ouzounis Dr Sophia Tsoka Paul Keeling, Sr Admin Officer, strategic planning MRC Centre for Developmental Neurobiology Dr Eric Blanc Randall Division of Cell and Molecular Biophysics Dr Franca Fraternali Department of Medical and Molecular Genetics Dr Thomas Schlitt Department of Computer Science Professor Maxime Crochemore Professor Mark Harman Professor Costas Iliopoulos Dr Kathleen Steinhöfel Division of Engineering Dr Mark Miodownik School of Medicine Professor Frank Nestle Dr Rebecca Oakey Dr Roli Roberts Dr Reiner Schulz Institute of Psychiatry Professor Simon Lovestone MRC Centre for Developmental Neurobiology Dr David Chambers Mathematics Department Professor Ton Coolen Visiting Professors Ben Blencowe, University of Toronto Peter D. Karp, SRI International, Benlo Park CA Nikos Kyrpides, Joint Genome Institute, Berkeley CA Arthur Lesk, Penn State University, University Park PA Alfonso Valencia, CNIO Madrid, Spain core and associate members

7 7 a visual summary of our work

8 8 the very basics the biological hierarchy populations organisms systems organs tissues cell types cells subcellular compartments macromolecular complexes macromolecules small molecules atoms … http://www.ehponline.org/members/2007/10373/fig1.jpg http://kentsimmons.uwinnipeg.ca/cm1504/Image48.gif

9 9 from DNA to gene measuring length: Units of length for DNA molecules Because DNA is double-stranded, the lengths of molecules are described as so many base pairs (bp). A kilobase pair (kb) is 10 3 bp and a megabase pair (Mb) is 10 6 bp. A gigabase pair (Gb) is 10 9 Mb. In summary: 1 kb = 1000 bp 1 Mb = 1000 kb = 1 000 000 bp 1 Gb = 1000 Mb = 1 000 000 kb = 1 000 000 000 bp Typically, genome sizes range from Mbs to Gbs - and they contain between 1,000 and 100,000 genes http://www.ncbi.nlm.nih.gov/books/bv.fcgi?rid=genomes.box.5275

10 10 a gene in ascii : acgt ATGCCCGTTGCCCACGTTGCCTTGCCCGTTCCGCTTCCTCGTACCTTTGACTATCTGCTGCCAGAAGGCAT GACGGTTAAAGCTGGGTGTCGCGTGCGCGTGCCGTTTGGCAAACAGCAGGAGCGCATCGGGATTGTGGT ATCAGTTAGCGATGCCAGCGAACTGCCGCTCAATGAGCTAAAAGCGGTAGTCGAAGTGCTGGATAGTGAG CCGGTGTTTACTCACTCCGTCTGGCGATTGCTGCTATGGGCGGCAGATTACTATCATCATCCGATTGGCGA TGTGCTGTTTCATGCCTTGCCGATTTTACTACGCCAGGGGCGGCCTGCGGCGAACGCGCCGATGTGGTAC TGGTTTGCCACTGAACAAGGCCAGGCGGTGGATCTGAACAGCCTGAAACGCTCCCCCAAGCAACAACAGG CGCTGGCGGCGTTACGGCAAGGCAAAATCTGGCGCGACCAGGTCGCCACGCTCGAATTTAATGATGCCG CGTTGCAGGCGCTACGCAAAAAAGGTCTGTGTGATTTAGCAAGTGAAACACCAGAGTTTAGCGACTGGCGA ACGAACTATGCCGTTTCTGGTGAGCGGTTGCGATTGAATACCGAACAGGCCACCGCCGTTGGCGCAATTC ATAGCGCGGCAGATACTTTTTCTGCCTGGCTGCTGGCGGGCGTTACCGGTTCCGGTAAAACGGAGGTTTA TCTCAGCGTACTGGAAAACGTGCTCGCTCAGGGCAAACAGGCGCTGGTGATGGTGCCGGAAATCGGCCTG ACACCGCAAACTATCGCCCGTTTTCGTGAACGTTTTAATGCCCCCGTGGAAGTTCTGCATTCCGGCCTGAA CGACAGCGAGCGTCTTTCGGCGTGGCTGAAAGCGAAAAATGGTGAGGCGGCGATTGTGATCGGCACCCG CTCCGCGCTGTTTACGCCGTTTAAAAATCTCGGCGTGATTGTCATTGATGAAGAGCACGACAGCTCCTACA AGCAGCAGGAAGGCTGGCGCTATCATGCCCGCGACCTGGCGGTGTATCGTGCGCACAGCGAGCAAATCC CGATTATTCTTGGCTCCGCAACGCCCGCGCTGGAAACGTTATGCAACGTCCAGCAGAAAAAATACCGCCTG CTGCGCCTGACCCGTCGGGCAGGGAATGCGCGTCCGGCAATTCAACATGTGCTGGATTTAAAAGGTCAGA AGGTGCAGGCAGGTCTGGCTCCGGCGTTAATCACTCGTATGCGCCAGCATTTACAGGCTGATAACCAGGT CATTCTCTTTCTTAACCGCCGTGGCTTTGCGCCTGCACTGCTGTGCCACGACTGTGGCTGGATTGCCGAAT GCCCACGTTGCGATCACTACTACACGCTGCATCAGGCGCAGCACCATCTGCGCTGCCACCACTGTGACAG TCAGCGTCCGGTGCCGCGCCAGTGCCCTTCCTGCGGTTCCACGCACCTGGTCCCCGTGGGGCTGGGCAC CGAACAGCTTGAACAGACGCTCGCGCCGTTGTTCCCCGGCGTGCCCATTTCTCGTATCGACCGCGATACC ACCAGCCGCAAAGGGGCGCTGGAACAGCAACTGGCAGAAGTACATCGCGGCGGCGCGCGGATTTTGATT GGTACACAAATGCTGGCGAAAGGTCACCATTTCCCGGATGTGACGCTGGTTGCATTACTGGACGTGGACG GCGCGCTGTTTTCTGCCGATTTTCGCTCGGCAGAGCGTTTCGCTCAGCTTTACACCCAGGTCGCCGGTCG TGCCGGGCGTGCGGGTAAACAGGGCGAAGTGGTGCTGCAAACGCACCATCCGGAACATCCTCTGTTGCAA ACGTTGCTCTATAAAGGCTACGACGCCTTTGCCGAACAGGCGCTGGCTGAGCGGCGAATGATGCAGCTAC CGCCGTGGACCAGCCATGTGATTGTGCGTGCGGAAGATCATAACAATCAGCACGCGCCATTGTTCCTGCA ACAACTGCGTAATCTGATCCTCTCCAGCCCACTGGCAGACGAGAAACTGTGGGTTCTCGGTCCGGTTCCG GCTCTGGCACCTAAACGTGGCGGTCGCTGGCGCTGGCAGATATTGTTGCAGCACCCTTCCCGCGTGCGCT TGCAACACATCATTAACGGTACGCTGGCGCTCATCAATACAATACCGGATTCCCGTAAGGTGAAATGGGTG CTGGATGTTGATCCGATTGAGGGTTAA

11 11 a protein in ascii : acdefghiklmnpqrstvwy MPVAHVALPVPLPRTFDYLLPEGMTVKAGCRVRVPFGKQ QERIGIVVSVSDASELPLNELKAVVEVLDSEPVFTHSVWR LLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYW FATEQGQAVDLNSLKRSPKQQQALAALRQGKIWRDQVAT LEFNDAALQALRKKGLCDLASETPEFSDWRTNYAVSGER LRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLS VLENVLAQGKQALVMVPEIGLTPQTIARFRERFNAPVEVL HSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFKNLGV IVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSA TPALETLCNVQQKKYRLLRLTRRAGNARPAIQHVLDLKGQ KVQAGLAPALITRMRQHLQADNQVILFLNRRGFAPALLCH DCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPR QCPSCGSTHLVPVGLGTEQLEQTLAPLFPGVPISRIDRDT TSRKGALEQQLAEVHRGGARILIGTQMLAKGHHFPDVTL VALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQG EVVLQTHHPEHPLLQTLLYKGYDAFAEQALAERRMMQLP PWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADEKL WVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIINGTL ALINTIPDSRKVKWVLDVDPIEG

12 12 many genomes have been deciphered

13 13 domains of life there are three known domains / types of cells: archaea, bacteria, eukarya http://tainano.com/Molecular%20Biology%20Glossary.files/image015.gif http://www.biologyreference.com/Ar-Bi/Archaea.html http://www.garlandscience.com/textbooks/0815341059.asp

14 14 genome trees better trees are derived from whole- genome comparisons

15 15 the eukarya, us eukarya are very diverse ! http://wiki.cotch.net/upload/5/5f/Eukaryoticlife.jpg

16 16 structure BIOLOGY & BIOINFORMATICS visualization & interpretation of scientific results who are we, the centre for bioinformatics a crash course in biology a movie: the inner life of a cell CREATIVITY IN SCIENCE creativity, definitions importance of creativity, co-occurrence of terms artists on science, scientists on art science communication, good examples ARTISTIC VALUE IN SCIENTIFIC RESULTS importance of science? neurobiology of perception genome evolution, a case study the importance of scales, and the media

17 17 creativity

18 18 creativity, co-occurrence terms

19 19 creativity barometer

20 20 creativity in society

21 21 visual arts in sciences

22 22 artists on science, scientists on art a relevant dialogue, e.g. "Artists on science: scientists on art." Special section in Nature, 17 March 2005, pages 293-323 distinction of two cultures, science & technology vs. art & poetry is somewhat outdated … There is an economy of words and beauty of concept in poetry that is always found in the best science (Garfield, 1989) Creativity is a modern concept. Term was not coined until 1875, when it was used to refer to the poetic imagination.

23 23 a piece of art from a famous scientist It may seem unusual to include Leonardo da Vinci in a list of paleontologists and evolutionary biologists. Leonardo was and is best known as an artist, the creator of such masterpieces as the Mona Lisa, Madonna of the Rocks, and The Last Supper. Yet Leonardo was far more than a great artist: he had one of the best scientific minds of his time. He made painstaking observations and carried out research in fields ranging from architecture and civil engineering to astronomy to anatomy and zoology to geography, geology and paleontology. http://www.ucmp.berkeley.edu/history/vinci.html

24 24 the importance of science communication http://www.auburn.edu/~mathest/nufs2000_clip_image002_0000.jpg http://www.flickr.com/photos/rafaerts/2817098501/

25 25 structure BIOLOGY & BIOINFORMATICS visualization & interpretation of scientific results who are we, the centre for bioinformatics a crash course in biology a movie: the inner life of a cell CREATIVITY IN SCIENCE creativity, definitions importance of creativity, co-occurrence of terms artists on science, scientists on art science communication, good examples ARTISTIC VALUE IN SCIENTIFIC RESULTS importance of science? neurobiology of perception genome evolution, a case study the importance of scales, and the media

26 26 the importance of science? Science poll Published: Wednesday, 28 January 2009 The public was asked what has the most impact in shaping their futures; 26% said science, putting it ahead of politics, family and religion. When asked to choose which group of people has the most effect on our daily lives, only 3% selected scientists. http://sciencesowhat.direct.gov.uk/

27 27 neurobiology of perception Elements of perspective, shadows, transparency, reflections: all understood in terms of visual computations in our brain

28 28 microphotography http://www.nikonsmallworld.com/

29 29 a sense of scale Genomes377 Genes 1,315,558 Annotations 359,482 Similarities384,579,409 Phylogenetic profiles 181,986 Families 82,692 Interactions2,192,019 Pathways > 25,000

30 30 protein classification & similarity graphs http://bioinformatics.icmb.utexas.edu/lgl/Images/scop_hie_full.jpg http://bioinformatics.icmb.utexas.edu/lgl/Images/phg.jpg

31 31 more views of the similarity graph http://bioinformatics.icmb.utexas.edu/lgl/PHN/phn.large.png

32 32 zooming into the unknown

33 33 a sense of scale Genomes377 Genes 1,315,558 Annotations 359,482 Similarities384,579,409 Phylogenetic profiles 181,986 Families 82,692 Interactions2,192,019 Pathways > 25,000

34 34 ancestral gene content

35 35 1708

36 36 Gene content reconstruction: ancestral states Both current and ancient genomes HGT events on tree The enigmatic yellow sphere is the universal ancestor Featured in Wired, Discover etc. network of life

37 37

38 38 net of life, the movie http://www.nature.com/embor/journal/v8/n10/full/7401074.html

39 39 the importance of scales, and the media for artists, other scales do not provide typical material there is a beauty in the microcosm, stunning views that need to be captured stunning representations of complex phenomena with artistic value inaccessible in their usual form to wider communities including other scientists, artists and the general public these representations (results) are abstract notions they do not correspond to the physical world they do, however, provide the means for effective science communication with the appropriate use of media and inter-disciplinary collaborations results of complex analyses can have both artistic content and scientific accuracy


Download ppt "Artistic value in scientific results, a means for science communication creative kings 10-mar-2009"

Similar presentations


Ads by Google