Download presentation
Presentation is loading. Please wait.
Published bySuzanna Hines Modified over 8 years ago
1
The Ensembl API European Bioinformatics Institute Hinxton, Cambridge, UK
2
What is the API? Wikipedia defines an Application Programming Interface as: “... a set of definitions of the ways in which one piece of computer software communicates with another. It is a method of achieving abstraction, usually (but not necessarily) between lower-level and higher-level software. One of the primary purposes of an API is to provide a set of commonly- used functions.” The Ensembl API is a framework for applications that need to access or store data in Ensembl's databases.
3
Java API (EnsJ) System Context www Pipeline Apollo Mart DB MartShell MartView Other Scripts & Applications Ensembl DBs Perl API
4
The Perl API Written in Object-Oriented Perl. Used to retrieve data from and to store data in Ensembl databases. Foundation for the Ensembl Pipeline and Ensembl Web interface.
5
Why use an API? Uniform method of access to the data. Avoid writing the same thing twice: reusable in different systems. Reliable: lots of hard work, testing and optimisation already done. Insulates developers to underlying changes at a lower level (i.e. the database).
6
Data Objects Information is obtained from the API in the form of Data Objects. A Data Object represents a piece of data that is (or can be) stored in the database. Exon Transcript ExonMarkerGene
7
Data Objects – Code Example # print out the start, end and strand of a transcript print $transcript->start(), '-', $transcript->end(), '(',$transcript->strand(), “)\n”; # print out the stable identifier for an exon print $exon->stable_id(), “\n”; # print out the name of a marker and its primer sequences print $marker->display_marker_synonym()->name, “\n”; print “left primer: ”, $marker->left_primer(), “\n”; print “right primer: ”, $marker->right_primer(), “\n”; # set the start and end of a simple feature $simple_feature->start(10); $simple_feature->end(100);
8
Object Adaptors Object Adaptors are factories for Data Objects. Data Objects are retrieved from and stored in the database using Object Adaptors. Each Object Adaptor is responsible for creating objects of only one particular type. Data Adaptor fetch, store, and remove methods are used to retrieve, save, and delete information in the database.
9
Object Adaptors – Code Example # fetch a gene by its internal identifier $gene = $gene_adaptor->fetch_by_dbID(1234); # fetch a gene by its stable identifier $gene = $gene_adaptor->fetch_by_stable_id('ENSG0000005038'); # store a transcript in the database $transcript_adaptor->store($transcript); # remove an exon from the database $exon_adaptor->remove($exon); # get all transcripts having a specific interpro domain @transcripts = @{$transcript_adaptor->fetch_all_by_domain('IPR000980')};
10
The DBAdaptor The Database Adaptor is a factory for Object Adaptors. It is used to connect to the database and to obtain Object Adaptors. DB DBAdaptor GeneAdaptorMarkerAdaptor... Gene Mark er …
11
The DBAdaptor – Code Example use Bio::EnsEMBL::DBSQL::DBAdaptor; # connect to the database: $dbCore = Bio::EnsEMBL::DBSQL::DBAdaptor->new (-host => ‘ensembldb.ensembl.org’, -dbname => ‘homo_sapiens_core_41_36c’, -species => 'human', -group => 'core', -user => ‘anonymous’); # get a GeneAdaptor $gene_adaptor = $dbCore->get_GeneAdaptor(); # get a TranscriptAdaptor $transcript_adaptor = $dbCore->get_TranscriptAdaptor();
12
The Registry Is a central store of all the DBAdaptors Automatically adds DBAdaptors on creation Adaptors can be retrieved by using the species, database type and Adaptor type. Enables you to specify configuration scripts Very useful for multi species scripts.
13
Registry configuration file use Bio::EnsEMBL::DBSQL::DBAdaptor; use Bio::EnsEMBL::Utils::ConfigRegistry; my $reg = "Bio::EnsEMBL::Registry"; my @a = ('H_Sapiens', 'homo sapiens', 'human', 'Homo_Sapient',"Homo sapiens"); Bio::EnsEMBL::Utils::ConfigRegistry-> add_alias( -species => "Homo_sapiens", -alias => \@a); new Bio::EnsEMBL::DBSQL::DBAdaptor( -species => "Homo_sapiens", -group => "core", -host => 'ensembldb.ensembl.org', -user => 'anonymous', -dbname => 'homo_sapiens_core_41_36c');
14
Registry usage use Bio::EnsEMBL::Registry; my $reg = "Bio::EnsEMBL::Registry"; $reg->load_all(); $gene_adaptor = $reg->get_adaptor("human","core","Gene"); $gene = $gene_adaptor-> fetch_by_stable_id('ENSG00000184129');
15
load_registry_from_db Loads all the databases for the correct version of this API *Ensures you use the correct API and Database *Lazy loads so no database connections are made until requested Use -verbose option to print out the databases loaded
16
Registry Usage use Bio::EnsEMBL::Registry; my $reg = "Bio::EnsEMBL::Registry"; $reg->load_registry_from_db( -host => 'ensembldb.ensembl.org', -user => 'anonymous'); $gene_adaptor = $reg->get_adaptor("human","core","Gene");
17
Coordinate Systems Ensembl stores features and sequence in a number of coordinate systems. Example coordinate systems: chromosome, clone, scaffold, contig Chromosome CoordSystem 1, 2,..., X, Y Clone CoordSystem AC105024, AC107993, etc.
18
Coordinate Systems Regions in one coordinate system may be constructed from a tiling path of regions from another coordinate system. Chromosome 17 BAC clones Gap
19
Coordinate Systems – Code Example # get a coordinate system adaptor $csa = Bio::EnsEMBL::Registry-> get_adaptor(“human”,”core”,”coordsystem”); # print out all of the coord systems in the db $coord_systems = $csa->fetch_all(); foreach $cs (@$coord_systems) { print $cs->name(), ' ',$cs->version, “\n”; } chromosome NCBI36 supercontig clone contig Sample output:
20
Slices A Slice Data Object represents an arbitrary region of a genome. Slices are not directly stored in the database. A Slice is used to request sequence or features from a specific region in a specific coordinate system. chr20 Clone AC022035
21
Slices – Code Example # get the slice adaptor $slice_adaptor = $reg->get_adaptor(“human”,”core”,”slice”); # fetch a slice on a region of chromosome 12 $slice = $slice_adaptor->fetch_by_region('chromosome', '12', 1e6, 2e6); # print out the sequence from this region print $slice->seq(); # get all clones in the database and print out their names @slices = @{$slice_adaptor->fetch_all('clone')}; foreach $slice (@slices) { print $slice->seq_region_name(), “\n”; }
22
Features Features are Data Objects with associated genomic locations. All Features have start, end, strand and slice attributes. Features are retrieved from Object Adaptors using limiting criteria such as identifiers or regions (slices). chr20 Clone AC022035
23
Features in the database Gene Transcript Exon PredictionTranscript PredictionExon DnaAlignFeature ProteinAlignFeature SimpleFeature MarkerFeature QtlFeature MiscFeature KaryotypeBand RepeatFeature AssemblyExceptionFeature DensityFeature
24
A Complete Code Example use Bio::EnsEMBL::Registry; my $reg = "Bio::EnsEMBL::Registry"; $reg->load_registry_from_db( -host => 'ensembldb.ensembl.org', -user => 'anonymous'); $slice_ad = $reg->get_adaptor(“human”,”core”,”slice”); $slice = $slice_ad->fetch_by_region('chromosome', 'X', 1e6, 10e6); foreach $sf (@{$slice->get_all_SimpleFeatures()}) { $start = $sf->start(); $end = $sf->end(); $strand = $sf->strand(); $score = $sf->score(); print “$start-$end($strand) $score\n”; }
25
Genes, Transcripts, Exons Genes, Transcripts and Exons are objects that can be used just like any other Feature object. A Gene is a set of alternatively spliced Transcripts. A Transcript is a set of Exons
26
Genes, Transcripts, Exons – Code Example # fetch a gene by its stable identifier $gene = $gene_adaptor->fetch_by_stable_id('ENSG00000123427'); # print out the gene, its transcripts, and its exons print “Gene: “, get_string($gene), “\n”; foreach $transcript (@{$gene->get_all_Transcripts()}) { print “ Transcript: “, get_string($transcript), “\n”; foreach $exon (@{$transcript->get_all_Exons()}) { print “ Exon: “, get_string($exon), “\n”; } # helper function: returns location and stable_id string sub get_string { $feature = shift; $stable_id = $feature->stable_id(); $seq_region = $feature->slice()->seq_region_name(); $start = $feature->start(); $end = $feature->end(); $strand = $feature->strand(); return “$stable_id $seq_region:$start-$end($strand)”; }
27
Genes, Transcripts, Exons – Sample Output Gene: ENSG00000123427 12:56452650-56462590(1) Transcript: ENST00000300209 12:56452650-56462590(1) Exon: ENSE00001180238 12:56452650-56452951(1) Exon: ENSE00001354204 12:56453067-56453178(1) Exon: ENSE00001354199 12:56460305-56462590(1) Transcript: ENST00000337139 12:56454741-56462451(1) Exon: ENSE00000838990 12:56454741-56454812(1) Exon: ENSE00001246483 12:56454943-56454949(1) Exon: ENSE00001141252 12:56460305-56462451(1) Transcript: ENST00000333012 12:56452728-56462590(1) Exon: ENSE00000838993 12:56452728-56452951(1) Exon: ENSE00001354204 12:56453067-56453178(1) Exon: ENSE00001246506 12:56454679-56454817(1) Exon: ENSE00001336722 12:56460305-56462590(1)
28
Translations Translations are not Features. A Translation object defines the UTR and CDS of a Transcript. Peptides are not stored in the database, they are computed on the fly using Translation objects. Translation
29
Translations – Code Example # fetch a transcript from the database $transcript = $transcript_adaptor->fetch_by_stable_id('ENST00000333012'); # obtain the translation of the transcript $translation = $transcript->translation(); # print out the translation info print “Translation: “, $translation->stable_id(), “\n”; print “Start Exon: “,$translation->start_Exon()->stable_id(),“\n”; print “End Exon: “, $translation->end_Exon()->stable_id(), “\n”; # start and end are coordinates within the start/end exons print “Start : “, $translation->start(), “\n”; print “End : “, $translation->end(), “\n”; # print the peptide which is the product of the translation print “Peptide : “, $transcript->translate()->seq(), “\n”;
30
Translations – Sample Output Translation: ENSP00000327425 Start Exon: ENSE00000838993 End Exon: ENSE00001336722 Start : 3 End : 22 Peptide : SERRPRCPGTPLAGRMADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQN FGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGAYGLVRET EDDVIEQELWRGMRGACGHALSMSTMTPWESIKGSSVRGGCYHH
31
Coordinate Transformations The API provides the means to convert between any related coordinate systems in the database. Feature methods transfer, transform, project can be used to move features between coordinate systems. Slice method project can be used to move features between coordinate systems.
32
Feature::transfer The Feature method transfer moves a feature from one Slice to another. The Slice may be in the same coordinate system or a different coordinate system. Chr20 Chr17 AC099811 Chr17 ChrX
33
Feature::transfer – Code Example # fetch an exon from the database $exon = $exon_adaptor->fetch_by_stable_id('ENSE00001180238'); print “Exon is on slice: “, $exon->slice()->name(), “\n”; print “Exon coords: “, $exon->start(), '-', $exon->end(), “\n”; # transfer the exon to a small slice just covering it $exon_slice = $slice_adaptor->fetch_by_Feature($exon); $exon = $exon->transfer($exon_slice); print “Exon is on slice: “, $exon->slice()->name(), “\n”; print “Exon coords: “, $exon->start(), '-', $exon->end(), “\n”; Sample output: Exon is on slice: chromosome:NCBI35:12:1:132449811:1 Exon coords: 56452650-56452951 Exon is on slice: chromosome:NCBI35:12:56452650:56452951:1 Exon coords: 1-302
34
Feature::transform Transform is like the transfer method but it does not require a Slice argument, only the name of a Coordinate System. Chr20 Chr17 AC099811 Chr17 AC099811
35
Feature::transform – Code Example # fetch a prediction transcript from the database $pta = $db->get_PredictionTranscriptAdaptor(); $pt = $pta->fetch_by_dbID(1834); print “Prediction Transcript: “, $pt->stable_id(), “\n”; print “On slice: “, $pt->slice()->name(), “\n”; print “Coords: “, $pt->start(), '-', $pt->end(), “\n”; # transform the prediction transcript to the supercontig system $pt = $pt->transform('supercontig'); print “On slice: “, $pt->slice()->name(), “\n”; print “Coords: “, $pt->start(), '-', $pt->end(), “\n”; Sample output: Prediction Transcript: GENSCAN00000001834 On slice: contig::AL390876.19.1.185571:1:185571:1 Coords: 131732-174068 On slice: supercontig::NT_008470:1:40394264:1 Coords: 10814989-10857325
36
Feature::project Project does not move a feature, but it provides a definition of where a feature lies in another coordinate system. It is useful to determine where a feature that spans multiple sequence regions lies. Chr17 AC099811 Chr17 AC099811
37
Feature::project – Code Example # fetch a transcript from the database $tr = $transcript_adaptor->fetch_by_stable_id('ENST00000351033'); $cs = $tr->slice()->coord_system(); print “Coords: “, $cs->name(), ' ', $tr->slice->seq_region_name(),' ', $tr->start(), '-', $tr->end(), '(', $tr->strand(), “)\n”; # project to the clone coordinate system foreach $segment (@{$tr->project('clone')}) { ($from_start, $from_end, $pslice) = @$segment; print “$from_start-$from_end projects to clone region: “; print $pslice->seq_region_name(), ' ', $pslice->start(), '-', $pslice->end(), “(“, $pslice->strand(), ”)\n”; }
38
Feature::project – Sample Output Coords: chromosome 1 147647-147749(-1) 1-103 projects to clone region: AL627309.15 147271-147373(-1)
39
Slice::project Slice::project acts exactly like Feature::project, except that it works with a Slice instead of a Feature. It is used to determine how one coordinate system is made of another. Chr17 AC099811 Chr17 AC099811
40
Slice::project – Code Example # fetch a slice on a region of chromosome 5 $slice = $slice_adaptor->fetch_by_region('chromosome', '5', 10e6, 12e6); # project to the clone coordinate system foreach $segment (@{$slice->project('clone')}) { ($from_start, $from_end, $pslice) = @$segment; print “$from_start-$from_end projects to clone region: “; print $pslice->seq_region_name(), ' ', $pslice->start(), '-', $pslice->end(), “(“, $pslice->strand(), ”)\n”; }
41
Slice::project – Sample Output 1-55893 projects to clone region: AC010629.8 24890-80782(1) 55894-151517 projects to clone region: AC091905.3 423-96046(1) 151518-296668 projects to clone region: AC034229.4 768-145918(1) 296669-432616 projects to clone region: AC012640.12 1-135948(-1) 432617-562215 projects to clone region: AC092336.2 1-129599(-1) 562216-646577 projects to clone region: AC112200.3 1-84362(-1) 646578-722633 projects to clone region: AC106760.2 2135-78190(1) 722634-889200 projects to clone region: AC012629.9 1-166567(-1) 889201-1030964 projects to clone region: AC010626.6 18549-160312(1) 1030965-1148679 projects to clone region: AC005610.1 105694- 223408(1) 1148680-1286532 projects to clone region: AC004648.1 1-137853(-1) 1286533-1367657 projects to clone region: AC005367.1 463-81587(1) 1367658-1488052 projects to clone region: AC003954.1 1-120395(-1) 1488053-1522377 projects to clone region: AC004633.1 1901-36225(1) 1522378-1776593 projects to clone region: AC010433.9 4714-258929(1) 1776594-1950687 projects to clone region: AC113390.3 22452-196545(1) 1950688-1994121 projects to clone region: AC127460.2 1-43434(-1) 1994122-2000001 projects to clone region: AC114289.2 164862-170741(- 1)
42
External References Ensembl cross references its Gene predictions with identifiers from other databases. Q9UBS0 ENSP00000308413 RPS6KB2 ENSP00000267071 BRCA2 P51587 Ensembl SwissProt HUGO
43
External References – Code Example # fetch a transcript using an external identifier ($transc) = @{$transcript_adaptor->fetch_all_by_external_name('TTN')}; print “TTN is Ensembl transcript “,$transc->stable_id(),“\n”; # get all external identifiers for a translation $transl = $transc->translation(); print “External identifiers for “, $transl->stable_id(), “:\n”; foreach my $db_entry (@{$transl->get_all_DBEntries()}) { print $db_entry->dbname(), “:”, $db_entry->display_id(),”\n”; }
44
External References – Sample Output TTN is Ensembl transcript ENST00000286104 External identifiers for ENSP00000286104: GO:GO:0005524 GO:GO:0016020 GO:GO:0005975 GO:GO:0006979 GO:GO:0004674 GO:GO:0006468 GO:GO:0004713 GO:GO:0004896 GO:GO:0007517 GO:GO:0008307 Uniprot/SPTREMBL:Q10465 EMBL:X90569 protein_id:CAA62189.1 GO:GO:0006941 GO:GO:0030017 GO:GO:0004601 Uniprot/SPTREMBL:Q8WZ42 EMBL:AJ277892 protein_id:CAD12456.1
45
Getting More Information perldoc – Viewer for inline API documentation. Also online at: http://www.ensembl.org/info/software/Pdoc/ensembl/index.html Tutorial document: http://www.ensembl.org/info/software/core/core_tutorial.html ensembl-dev mailing list:
46
Acknowledgements Ensembl Core Software Team: Glenn Proctor Patrick Meidl Ian Longden The Rest of the Ensembl Team.
Similar presentations
© 2024 SlidePlayer.com Inc.
All rights reserved.