Presentation is loading. Please wait.

Presentation is loading. Please wait.

Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,

Published byLawrence Tyler Modified over 8 years ago

Similar presentations

Presentation on theme: "Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,"— Presentation transcript:

1 Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala, Puspita Lisdiyanti, Tomohiko Tamura and Ken-ichiro Suzuki Antonie van Leeuwenhoek Corresponding author: Moriyuki Hamada Biological Resource Center, National Institute of Technology and Evaluation (NBRC) E-mail: hamada-moriyuki@nite.go.jp

2 99 98 99 94 98 72 79 99 81 99 91 86 73 92 99 71 75 73 0.01 Myceligenerans xiligouense XLG9A10.2 T (AY354285) Promicromonospora citrea DSM 43110 T (X83808) Xylanibacterium ulmi XIL08 T (AY273185) Xylanimicrobium pachnodae VPCX2 T (AF105422) Xylanimonas cellulosilytica XIL07 T (AF403541) Isoptericola chiayiensis 06182M-1 T (FJ469988) Isoptericola halotolerans YIM 70177 T (AY789835) Isoptericola jiangsuensis CLG T (EU852101) Isoptericola dokdonensis DS-3 T (DQ387860) Isoptericola variabilis NBRC 104115 T (AB489221) Isoptericola nanjingensis H17 T (HQ222356) Isoptericola hypogeus HKI0342 T (AJ854061) Cellulosimicrobium cellulans DSM 43879 T (X79455) Luteimicrobium xylanilyticum W-15 T (JQ039191) Luteimicrobium album RI148-Li105 T (AB646194) Luteimicrobium subarcticum R19-04 T (AB489904) Demequina aestuarii NBRC 106260 T (AB639015) Lysinimicrobium mangrovi HI08-69 T (AB639012) Actinotalea fermentans NBRC 105374 T (AB639014) Cellulomonas bogoriensis 69B4 T (X92152) Cellulomonas carbonis T26 T (HQ702749) Cellulomonas hominis DMMZ CE40 T (X82598) Cellulomonas denverensis W6929 T (AY501362) Cellulomonas gelida DSM 20111 T (X83800) Cellulomonas uda DSM 20107 T (X83801) Cellulomonas iranensis O T (AF064702) Cellulomonas composti TR7-06 T (AB166887) Cellulomonas flavigena DSM 20109 T (X83799) Cellulomonas marina FXJ8.089 T (JF346422) Cellulomonas oligotrophica Kc5 T (AB602499) Cellulomonas fimi DSM 20113 T (X79460) Cellulomonas biazotea DSM 20112 T (X83802) Cellulomonas chitinilytica X.bu-b T (AB268586) Cellulomonas cellasea DSM 20118 T (X83804) Cellulomonas soli Kc1 T (AB602498) Cellulomonas humilata NCTC 25174 T (X82449) Cellulomonas xylanilytica XIL11 T (AY303668) Cellulomonas terrae DB5 T (AY884570) Tropicihabitans flavus PS-14-16 T (AB971840) Tropicihabitans flavus RS-7-1 (AB971841) Oerskovia paurometabola DSM 14281 T (AJ314851) Oerskovia jenensis DSM 46000 T (AJ314848) Oerskovia turbata DSM 20577 T (X83806) Oerskovia enterophila DSM 43852 T (X83807) Sediminihabitans luteus H97-3 T (AB695376) Sanguibacter keddieii ST-74 T (X79450) Sanguibacter antarcticus KOPRI21702 T (EF211071) Sanguibacter soli DCY22 T (EF547937) Paraoerskovia sediminicola H25-14 T (AB695378) Paraoerskovia marina NBRC104352 T (AB695379) Brevibacterium linens DSM 20425 T (X77451) Supplementary Fig. S1. Maximum-likelihood tree derived from the 16S rRNA gene sequences of strains PS-14-16 T and RS-7-1 and their taxonomic neighbours. The 16S rRNA gene sequence of Brevibacterium linens DSM 20425 T (X77451) was used as the outgroup. Bootstrap values (>70 %) based on 1000 replicates are shown at branch nodes.

3 95 99 92 99 84 98 77 75 99 76 98 71 87 99 74 95 88 94 80 10 Myceligenerans xiligouense XLG9A10.2 T (AY354285) Promicromonospora citrea DSM 43110 T (X83808) Xylanibacterium ulmi XIL08 T (AY273185) Xylanimicrobium pachnodae VPCX2 T (AF105422) Xylanimonas cellulosilytica XIL07 T (AF403541) Isoptericola chiayiensis 06182M-1 T (FJ469988) Isoptericola halotolerans YIM 70177 T (AY789835) Isoptericola jiangsuensis CLG T (EU852101) Isoptericola dokdonensis DS-3 T (DQ387860) Isoptericola variabilis NBRC 104115 T (AB489221) Isoptericola nanjingensis H17 T (HQ222356) Isoptericola hypogeus HKI0342 T (AJ854061) Cellulosimicrobium cellulans DSM 43879 T (X79455) Luteimicrobium xylanilyticum W-15 T (JQ039191) Luteimicrobium album RI148-Li105 T (AB646194) Luteimicrobium subarcticum R19-04 T (AB489904) Demequina aestuarii NBRC 106260 T (AB639015) Lysinimicrobium mangrovi HI08-69 T (AB639012) Actinotalea fermentans NBRC 105374 T (AB639014) Cellulomonas bogoriensis 69B4 T (X92152) Cellulomonas carbonis T26 T (HQ702749) Cellulomonas hominis DMMZ CE40 T (X82598) Cellulomonas denverensis W6929 T (AY501362) Cellulomonas gelida DSM 20111 T (X83800) Cellulomonas uda DSM 20107 T (X83801) Cellulomonas iranensis O T (AF064702) Cellulomonas composti TR7-06 T (AB166887) Cellulomonas flavigena DSM 20109 T (X83799) Cellulomonas marina FXJ8.089 T (JF346422) Cellulomonas oligotrophica Kc5 T (AB602499) Cellulomonas fimi DSM 20113 T (X79460) Cellulomonas biazotea DSM 20112 T (X83802) Cellulomonas chitinilytica X.bu-b T (AB268586) Cellulomonas cellasea DSM 20118 T (X83804) Cellulomonas soli Kc1 T (AB602498) Cellulomonas humilata NCTC 25174 T (X82449) Cellulomonas xylanilytica XIL11 T (AY303668) Cellulomonas terrae DB5 T (AY884570) Tropicihabitans flavus PS-14-16 T (AB971840) Tropicihabitans flavus RS-7-1 (AB971841) Oerskovia paurometabola DSM 14281 T (AJ314851) Oerskovia jenensis DSM 46000 T (AJ314848) Oerskovia turbata DSM 20577 T (X83806) Oerskovia enterophila DSM 43852 T (X83807) Sediminihabitans luteus H97-3 T (AB695376) Sanguibacter keddieii ST-74 T (X79450) Sanguibacter antarcticus KOPRI21702 T (EF211071) Sanguibacter soli DCY22 T (EF547937) Paraoerskovia sediminicola H25-14 T (AB695378) Paraoerskovia marina NBRC104352 T (AB695379) Brevibacterium linens DSM 20425 T (X77451) Supplementary Fig. S2. Maximum-parsimony tree derived from the 16S rRNA gene sequences of strains PS-14-16 T and RS-7-1 and their taxonomic neighbours. The 16S rRNA gene sequence of Brevibacterium linens DSM 20425 T (X77451) was used as the outgroup. Bootstrap values (>70 %) based on 1000 replicates are shown at branch nodes.

4 Supplementary Fig. S3. Two-dimensional thin-layer chromatogram of polar lipids from strains PS- 14-16 T (A) and RS-7-1 (B). Abbreviations: DPG, diphosphatidylglycerol; PG, phosphatidylglycerol; PI, phosphatidylinositol; PIM: phosphatidylinositol mannoside. Chloroform-methanol-water (65:25:4) by volume was used in the first direction and chloroform-acetic acid-methanol-water (80:18:12:5) by volume in the second direction. The spray reagent, 5 % molybdophosphoric acid. DPG PG PI 1st 2nd DPG PG PIM PI PIM 1st 2nd (A)(B)

Download ppt "Tropicihabitans flavus gen. nov., sp. nov., a new member of the family Cellulomonadaceae Moriyuki Hamada, Chiyo Shibata, Arif Nurkanto, Shanti Ratnakomala,"

Similar presentations

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.

Supplementary Fig. 1 Transmission electron micrographs of strains a CCR04 and b CCR80 grown on nutrient agar for 24 h. a b.
Warm Up Section 4.3 Draw and label each of the following in a circle with center P. (1). Radius: (2). Diameter: (3). Chord that is NOT a diameter: (4).

Warm Up Section 4.3 Draw and label each of the following in a circle with center P. (1). Radius: (2). Diameter: (3). Chord that is NOT a diameter: (4).
Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.

Supplementary Fig. S1. 16S RNA Neighbor-joining (NJ) tree of Brevibacterium metallicus sp. nov. NM2E3 T (in bold) and related species of genus Brevibacterium.
MB-PO13 T S. graminisoli NBRC 108883 T S. shenzhenensis DSM 42034 T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.

MB-PO13 T S. graminisoli NBRC T S. shenzhenensis DSM T Fig. S1. Substrate mycelium appearance of strain MB-PO13 T and related Streptomyces.
Supplemental material 1.Spraying with ethephon produces an ethylene physiological response. One-month-old seedlings were sprayed with different concentrations.

Supplemental material 1.Spraying with ethephon produces an ethylene physiological response. One-month-old seedlings were sprayed with different concentrations.
Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.

Supplemental Fig. S1. Orange- and yellow-flowered cultivars of calendula used in this study. Alice OrangeOrange StarPompom OrangeOrange Gem Alice YellowGold.
Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,

Supplementary Information Formate-H 2 -lyase, a Driver of Hydrogenotrophic Processes in the Root-zone of a Methane-emitting Fen Sindy Hunger, Oliver Schmidt,
Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.

Miscanthus and Reed, a large perennial wetland grass, are receiving considerable attention as potential bio-energy crops because of their ability to produce.
Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.

Supplementary Fig. 1 ClustalW (2.1) multiple sequence alignment and comparison of deduced partial protein sequences of SOS1 in root tissues of wheat genotypes.
Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS 279.48 (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.

Trichoderma eijii sp. nov. Trichoderma pseudolacteum sp. nov. 10 changes Nectria cinnabarina CBS (AF163025) H. psychrophila Hy 8 (EU330957) H. microcitrina.
(BPL-1, BD, BP, BC, BSP1, BSP4, Bsa-2)

(BPL-1, BD, BP, BC, BSP1, BSP4, Bsa-2)
MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.

MAKRLVLFATVVIALVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ MAKRLVLFATVVIGLVALTVAEGEASRQLQCERELQESSLEACRLVVDQQLAGRLPWSTGLQMRCCQQLRDISAKCRPVAVSQVARQYGQ.
From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins

From: Phylogenetic Analysis of the ING Family of PHD Finger Proteins
A b b a a a a a a c a a b a a b a,b a,c a B c b,c a a,c a,c c a b,c b

A b b a a a a a a c a a b a a b a,b a,c a B c b,c a a,c a,c c a b,c b
Fig. 1. Locations of shelf station C3a and oceanic station S412.

Fig. 1. Locations of shelf station C3a and oceanic station S412.
Fig.1. Dendrogram depicting NJ/ML/MP trees constructed using –MEGA 6

Fig.1. Dendrogram depicting NJ/ML/MP trees constructed using –MEGA 6
Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia  I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,

Molecular characterization of dengue virus 1 from autochthonous dengue fever cases in Croatia  I.C. Kurolt, L. Betica-Radić, O. Daković-Rode, L. Franco,
Supplementary Fig. 2- Maximum likelihood phylogenetic trees drawn for the (a) VP1 gene of R2 strains, (b) VP2 gene of C2 strains, (c) VP3 gene of M2 strains,

Supplementary Fig. 2- Maximum likelihood phylogenetic trees drawn for the (a) VP1 gene of R2 strains, (b) VP2 gene of C2 strains, (c) VP3 gene of M2 strains,
gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)

gt 3 gt 1 gt 2 gt 4 swHEV sw-NL Netherlands (EU526647)
Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

Fig. S1 Electron micrographs showing the general morphology and binary fission of negatively stained cells of strain 3-0-1T. Cells were grown on R2A agar.

Similar presentations

Ads by Google