Presentation is loading. Please wait.

Presentation is loading. Please wait.

MdFBX1 1 ----------------MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR--------------CQ 70 MdFBX2 1 ----------------MSQVRECETPEDKVVEILSKLPPKSLIRFKCIRKSWCTIINSPSFVAKHLRISMDNKLSSTTCILLNR--------------CQ.

Similar presentations


Presentation on theme: "MdFBX1 1 ----------------MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR--------------CQ 70 MdFBX2 1 ----------------MSQVRECETPEDKVVEILSKLPPKSLIRFKCIRKSWCTIINSPSFVAKHLRISMDNKLSSTTCILLNR--------------CQ."— Presentation transcript:

1 MdFBX MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR CQ 70 MdFBX MSQVRECETPEDKVVEILSKLPPKSLIRFKCIRKSWCTIINSPSFVAKHLRISMDNKLSSTTCILLNR CQ 70 MdFBX MSQVSETETPEDRVVAIMSKLPPKSLMRFKCIRKSWCTVINSPSFVAKHLSNSVDNKFSSSTCILLNR SQ 70 MdFBX MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDNKFSSFTCILFNR CQ 70 MdFBX MSQLHETETPEDKVVEILSRLPPKCLMRFKCIRKSWCTLINSPSFVAKHLNNSMDNKLSSSTCILLNR SQ 70 MdFBX MSQVRESETPEDRVVEILSRLSPKSLLRFKCIRKSWCTLVNSPSFVAKHLSNSLENKLSSSTCILLNR SQ 70 MdFBX MSQEHESEAPEDRVVEILSRLPPKSLMRFKCIRNSWCTLINSPRFVAKHINNSVDNKLSSSTCILLHR SQ 70 MdFBX MSQVCESETPEDRVVETLSRLPPKSLMRFKCICKSWCTLINSLSFVAKHLNNSMDNKLSSSTCILLSR SQ 70 MdFBX MSQVRECETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 MdFBX MSQVHENETLEDRVVEILSRLLPKSLMRFKCIRKSWCTLINSPSFVAKQLSNSVDNKFSSSTCILLNR SQ 70 MdFBX MSQVHDSETLEDRIVEILSRLPPKSLMRFKCIRKPWCTLINSPSFVAKYLSNSVDNKLSSSTCILLNR TQ 70 MdFBX MLENITPEDRMIEILSKLPAKSLTRFKCIRKSWCTLINSPSFVAKHLNNSADSKLSSSTCILVNH SQ 67 MdFBX14 1 MSQVRKSETLKDRVTEMTQVRESETPEVRVAEILSRLPPKSLMRFKCIRKSWCTAINNPSFTAKHLSNSVDNKFSSSTCILLHR SH 86 MdFBX MSQVHESETPEDKVVEILSRLSPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDNKFSSCTRILFNR CQ 70 MdFBX MFQVRESETPENSVVETLSRLPPKSLMRFKCIRKSWCTLINSPSFVAKHFNNSMDNKLSSSTCILLSR SQ 70 MdFBX MSQVRESETPEDRMVGILSRLSPKSLLRFKCIRKSWCTLINSPSFVAKHLSNSLDNKLSSSTCILLNR SQ 70 MdFBX MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 MdFBX MSHVRQSKTPEDRVIEILSRLPPKSLMRFKCLHKSWFSLINSLSFVDKHLSNSVDNKLPSSTCILLNR SQ 70 MdFBX MLNKTVEMSQVHDSETPEDRVVEILSRLPPKSLMRFKCIHKSWCTLINSPSFVAKYLSNSVDNKLSSSTCILLNR TQ 77 MdSFBB3-alpha MSHVRESETPEDRVVEILSRLPPKSLMRFKCIHKSWFSLINNLSFVAKHLSNSVDNKLSSSTCILLNR SQ 70 MdSFBB3-beta MSQVHESETPEDKVVEILCRLPPKSLMRFKCIRKSWCTLINRPSFVAKHLNNSVDNKLSSSTCILLNR SQ 70 MdSFBB9-alpha MSQVRESETPEDQVVEILSRLPPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTGILLNR CQ 70 MdSFBB9-beta MSQVRESETLEDKVVEILSKLPPKSLMRFKCIRKSWCTIINSPSFVAKHLNNSMDYKLSSTTCILLNR CQ 70 PpSFBB1-gamma MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB2-gamma MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB3-gamma MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB4-alpha MSQVHESETPEDKVVEILSRLPPKSLIRFKCVRKSWCTIINSPSFVAKHLSNTVDNKFSSFTCILFNR SQ 70 PpSFBB4-beta MTQVRESETPEDRVAEILSRLPPKSLMRFKCIRKSWGTIINNPSFMAKHLSNSVDNKFSSSTSILLHR SQ 70 PpSFBB4-gamma MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB5-alpha MSQVHESETPQDKVVEILSRLTPKSLMRFKCVHKSWCTIINSPSFVAKHLSNTVDDKFSSFTCILFNR SQ 70 PpSFBB5-beta MTQVCESETLEDRMAEILSRLPPKSLMRFKCIRKSWCTVINNPSFMAKHLSNSVDKKFSSSTCILLHR SH 70 PpSFBB5-gamma MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB6-gamma MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSADNKLSSSTCILLNC SQ 70 PpSFBB7-gamma MSQVCESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB8-gamma MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBB9-gamma MSQVRESETPEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PpSFBBk-gamma MSQVRESETLEDRMVEILSRLPPKSLMRFKCIRKSWCTLINSPCFVAKHLSDSVDNKLSSSTCILLNC SQ 70 PdSFB MAFILRKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVGTHLHRNVTGHAQAYLLCLHHP PdSFBa MTFTPRKKEILIDILVRLPAKSLVRFLFTCKVWSDLISSSSFVSTHLNRNVTKHAHVYFLCFHHP PdSFBd MTFALRKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVGTHLHRNVTGHAQAYLLCLHHP PdSFBf MAFTLRKKEIMIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVSTHLHRNVRKHAHVYLLCLHHP PcSFB MTFTLRKNEILIDILARLPTKSLVRFLCTCKSWSDLIGSSSFVSTHLHWNVTKHARGYLLCLHHP PsSFBc MTVRLRKKEILIDILVRLPAKSLVRFLCTSKSWSDLIGSSSFVSTHLHRNDTIHAHVYLLCLHPS ParSFBc MTFTLRKKEILIDILVRLPAKSLIRFLSTCKSWSDLIGSSIFVSTHLCRNVTKHTHVYLLCLHHP PavSFB MIFALRKKETLIDILVRLPSKSLVRFLFTCKSWSDLICSSSFVSTQLHRNVTKHAQIYLLCLHHP PavSFB MTFSLRKEEILIDILVRLPAKSLVRFLCTCKSWSDLVGSSSFVSTHLHRNITKHAHVHLLCLHHP PavSFB MTFTLRKKDILIDILVRLPAKSLVRFLCTCKSWIDLIGSSSFISTHLHRNATKHTHVYLLCLHHP PavSFB MTFTLRKNEILIDILARLPTKSLVRFLCTCKSWSDLIGSSSFVSTHLHWNVTKHARGYLLCLHHP PavSLFL1-S MWEEMALRRILPRLPSKSLIRFKSVRKSWYTLINNSTFVENHLSNSMHNKLSTCILFNRFV QS 63 PavSLFL1-S MWEEMALRRILPRLPSKSLIRFKCVRKSWYNLINSPTFVENHLSNSMHNKLSTCVLFNRFV QR 63 PavSLFL1-S MWEEMALRRILPRLPSKSLMRFKCVRKSWYTLINNPTFVENHLSNSMHSKLSTCVLFSRFV QR 63 PavSLFL1-S MWEEMALRRILPRLPSKSLMRFKCVRKSWYTLINNPTFVENHLSNSMHSKLSTCVLFSHFV QS 63 PavSLFL2-S MATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDQHLSTSMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 82 PavSLFL3-S MTYFCKMTEEMEVQ-ILARLPPKSLMRFKCVCNSWHALLKNPHFVAKHLHLYNYQPSSTCILFKRSV LS 68 PmSFB MTFTLGKKEILIDILVRLPAKSLVRFLCTCKSWSDLIGSSSFVRTHLDRNVTKHAHVYLLCLHHP PmSFB MTFRRGKKEILIDILVRLPAKSIVRFTCTCKSWSDLIGSSSFVSTHLRRNVTKHAHVYLLCLHHQ PmSLF MTFSLRKKEILIDILVRLPAKSLVRFLCTCKSWGDLIGSSSFVSIHLNRNVTKHAHVYLLCLHHP PmSLFL1-Sf MWEEMALRHILPRLPSKSLMRFRCVRKSWYILINNPTFVENHLSNSMQSKLSTCVLFSRFV QS 63 PmSLFL2-S MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86 PmSLFL2-S MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86 PmSLFL2-Sf MMREMATLSKFSEDMMGNILSRLPPKSLMRFRCVLKSWHDLIDKPSFVDHHLSISMDNKVTSSTYVLLKHNVLTDPSIKDDEKAVR 86 PmSLFL3-S MEVQ-ILARLPPKSLMRFKCVCKSWHALLNNPHFVAKHLHLYNNQPSSTCVLFKRSV LS 58 PmSLFL3-Sf MTYFYKMTEEMEVQ-ILARLPPKSLMRFKCVCKSWHALLNNPHFVAKHLHLYNNQPSSTCVLFKRSV LS 68 PhSLFv MANGILKKLPEDLVFLILLTFPVKSLLRLKCISKAWSILIQSTTFINRHINRKTN---TKAEFILFKR PiSLF MANDILMKLPEDLVFLVLLTFPVKSLLRFKCISKAWSILIQSTTFINRHVNRKTN---TKDEFIIFKR PiSLF MANGILKKLPEDLVFLILLTFPVKSLMRFKCISKAWSILIQSTTFINRHINRKTN---TKDEFILFKR PiSLF MANGVLKKLPEDLVCLILLTFPVKSLMRFKCISKTWSILIQSTTFINRHVNRKTN---TKDEFILFKR PiSLF3A MKELPQDVVIYIFVMLPVKSLLRSKCTCKTFCHIIKSSTFINLHLNHTTN---FNDELVLLKR PiSLFL MTTRRMMNKLPEDVVIYILFRLPVKSLLRFKCTSKAWYTLILSDTFVKLHHNHATA---TKEEFILFIR PiSLFL2b MMLDGIMKHLPEDVAMYILSRFPVKALLRFKFISKTWSTLIESSTFINIHLNRATT---TNNEFLLFSR PiSLFL2d MTAMKKLPIDVVINILFRLPVKSLTRFKCVTKSWYSLIQSANFINRHLNRATA---VKDEFILFKR Pa MPNGILKKLPEDLVFLILLTFSVKSLMRFKCISKAFSILIQSTTFINRHVNHEIN---KEDEFILFKR Pa MANGILKKLPEDLVFLILLTFPVKSLLRFKCISKAWSILIQSTTFINRHINRKTN---TKAEFILFKR PaF MANGILKKLPEDLVFLILLTFPVKSLMRFKCISKSWSFLIQSTGFINRHVNRKTN---TKDEFILFKR NaDD MVGGIIKAIPEDVVIYVLIRLPVKSIMRFKCTSKTLYILIRSTSFSNIHLNHTTT---LQDELILFKR NaDD MVDGIMKELPEDLVIYVILMLPVKSLLRLKSSCITFCNIIKSSTFINLHLNRTTN---GKDELILFKR NaDD MVNGSIKKLPEDLVFCMLLRCPVKSLMRFKCISKVWYHFIQSTTFINLHLNRTTS---VENEFILFKH NaDD MVGGIIKAVPEDVVIYVLIRLPVKSIMRFKCTSKTLYILIRSTSFSDIHLNHTTT---SQDESILFKR NaDD MADGMVKKLPKDMLVYIILILPVKSLLRLKCVSKFWYTLLNSSTFVNLRVNRTTT---TNAEIILFKR NaDD MMLDGIMKKLPEDVVIYILSRFSVKSLLRFKFISKSWYTLIQSSTFINVHLNRSTI---TKNEFILFSR NaDD MEEVNDQRTKLPYDVMIDIMKRLPAKSVIRIKCVSKTWYYMINSPDFISIHYNYDY----PSKHFIVFKR NaDD MADGIVKKLPKDVVICIILILPVKSLLRFKCVSNSWRTLMQSSTFINLHLNRSTT---INDEIILFKH NaDD MIPKMGDGTVEKLPKDVVIYIILRLQVKSLIRFKCVSKTWYILIQSSTFIYLHLSHTTT---SNDELVLFKR NaDD ANGIVKKCPEDILIYVLLRLPLKSLMRFKCVTKTFYTFIQSTTFINLHLNRTTI---TKDECILFKC AhSLF1E MMDGRFPR-QDVTSEILLFSSVKSLLRFRLVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR AhSLF MMDRRFPR-QDVISEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR AhSLF2C MEKIADGHPLG-DDKLIEILLHLPVRSLVRFKCVSISWYNLIRSPTFCNKHFLTSR----RNDSVLLVRR AhSLF MMDGRFPR-QDVTSEILLFSSVKSLLRFRLVSKSWCSLIKSHDFIDNHLLRRQ----TNGNVMVVKR AhSLF MMDGRFPR-QDVISEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR AmSLFL MMDGRFPR-QDVINEILLFSSVKSLLRFRCVSKSWCSLIKSNDFIDNHLLRRQ----TNGNVMVVKR AT2G MDLLPYDVVEHILERLDVKSLLNCKSVSKQWRSTIRCRAFQERQLMHRRQS--CNPDVLLVS * Supplementary Figure 1. Amino acid sequence alignment of the S locus F-box genes.

2 MdFBX1 71 VHDFPDRSWKQDVFWSMINLSIDSDKNNLHYDVEDL-NIPFPM EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPD 151 MdFBX2 71 VHVFPDRSWKQDVFWSMTNLSIDSDEHNLHYDVEDL-NIPFPM EDQDNVEIHGYCNGIVCVIVGKNVL-----LCNPATREFRQLPN 151 MdFBX3 71 VHVFPDKSWKHEVLWSMINLFNERVARTLYYDVEDL-NIPFPR DDHQHVLIHGYCNGIVCVISGKNIL-----LCNPATREFRQLPD 151 MdFBX5 71 VHVFPDRSWKRDVFWSMINLSIDSDEHNLHYDVEDR-NIPFPI EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151 MdFBX6 71 AHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDL-IIPFPL EDHDFVLIFGYCNGIICVDAGKNVL-----LCNPATREFRQLPH 151 MdFBX7 71 FHIFPDQSWKREILWSMINLSIDSDVHNLHYDVKPL-NIPFPR DDHNPVQIHGYCNGIVCLIEGDNVL-----LCNPSTREFRLLPN 151 MdFBX8 71 TPIFPYDSWKREFFWSMINFSIDSDESNLHYDVEDLTNVPLLQW EDHHEVEIHGYCNGIVCVTVGEYFF-----LCNPATGEFSQLPN 153 MdFBX9 71 AHVFPDNSWKPEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL EGHDFVQIEGYCNGIVCVIAGTSLYLINVLLCNPATGKFRQLPP 156 MdFBX10 71 AHVCPEESWKQEVLWSMINLSIDGDE--LHYDVEDLTNVPFLK DDHHELEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 MdFBX11 71 THVFPDNSWKQEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL EDHDYVLILGYCNGIVCVTAGKNIL-----LCNPTTREFMRLPS 151 MdFBX12 71 MYVFPDQSWKYETLWSMMNLSNYSDEHNLHYDFKDL-NIPFPM EDHHPVQIHSYCNGIVCVITGKSVR----ILCNPATREFRQLPS 152 MdFBX13 68 PHIFPDKNWKQEVFWSMINISIDSDEHSLHYDVVDL-NIPFPL EDHDFVQIHGYCNGIVCVIVGKKFL-----LCNPATREFMQLPN 148 MdFBX14 87 MPVFPDRSWKREYFWSMINLSHDSDEHNLYYDVEDL-NIQFPL EDHDLVSVHGYCNGIVCLIVGKHAV-----LYNPATRELKQLPD 167 MdFBX15 71 VHVFPDRSWKRDVFWSMINLSFDSDEHNLHYDVEDR-NIPFPI EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151 MdFBX16 71 AHVFPDNSWKPEVFWSMINLSIDSDEHNLHYDVEDL-NIPFPL EGHDFVQIEGYCNGIVCVIAGTSLYLINVLLCNPATGKFRQLPP 156 MdFBX17 71 FHIFPDQSWKREVLWSMINLSSDSDVHNLHYDVKPL-NIPFSR DDHNPVQIHGYCNGIVCLIEGDNVL-----LCNPSTREFRLLPN 151 MdFBX18 71 AHIFPDQSWKQGVLWSVIYLSIDGDE--LHYDIEDLTNVPFLK DDHHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 MdFBX19 71 AHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDL-NIPFPL NDHDFVLIFGYCNGIVCIEAGKNVL-----LCNPATREFRQLPD 151 MdFBX20 78 MHVFPDQSWKYETLWSMMNLSNYSDEHNLQYDFKDL-NIPFPT EDHHPVQIHSYCNGIVCVITGKSVR----ILCNPATREFRQLPA 159 MdSFBB3-alpha 71 AHIFPDQSWKQEVFWSMINFSIDSDENNLHYDVEDL-NIPFAL KDHDFVLIFGYCNGILCVEAGKNVL-----LCNPATREFKQLPD 151 MdSFBB3-beta 71 AHIFPDQSWKQEVFWSTINLSIDSDEHNLHYDVEDL-IIPFPL EDHDFVLIFGYCNGIVCVDAGKNVL-----LCNPATREFRQLPD 151 MdSFBB9-alpha 71 VHVFSDRSWKQDVFWSMINLSIDSDKNNLYYDVEDL-NIPFPM EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPD 151 MdSFBB9-beta 71 VHVFPDRSWKQDVFWSMINLSIDSDEHNLHYDVEDI-NIPFPM EDQDNVELHGYCNGIVCVIVGKNVL-----LCNPATGEFRQLPN 151 PpSFBB1-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB2-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB3-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB4-alpha 71 VHVFADRSWKRDVFWSMINLSIESDEHNLDYDVEDL-NIPFPM EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151 PpSFBB4-beta 71 MPVFPDRSWKREYFWSMINLSHDSDEYNLYYDVEDL-NIQFPL EDHDHVSIHGYCNGIVCLIVGKNAV-----LYNPATRELKQLPD 151 PpSFBB4-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB5-alpha 71 VHVFADRSWKRDVFWSMVNLSIDSDEHNLHYDVKDL-NIPFPM EVQDNVQLYGYCNGIVCVIVGENVL-----LCNPATREFKQLPD 151 PpSFBB5-beta 71 MPVFPDGSWKREYFWSMINLSRDSDEHNLYYDVEDL-NVQFPL EDHEHISVHGYCNGIVCLIVGKNAL-----LYNPATRELKQLPD 151 PpSFBB5-gamma 71 AQVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB6-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDTEDLTIVPFLK DGPHEVEIHGYCDGIVCVPVDENFF-----LCNPATGEFRQLPD 150 PpSFBB7-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB8-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDENFF-----LCNPATGEFRQLPD 150 PpSFBB9-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DDPHEVEIHGYCDGIVCITVDENFF-----LCNPATGEFRQLPD 150 PpSFBBk-gamma 71 AHVCSEKSWKQEVSWSVINLSIDGDE--LHYDIEDLTIVPFLK DGPHEVEIHGYCDGIVCVTVDESFF-----LCNPATGEFRQLPD 150 PdSFB1 66 -NFECQRDDDDPYFKEELQWSLFSNVTFEESSKLSHPLGSTEHY VIYGSSNGLVCISDEIMNFDSPIHIWNPSVKKLRTTPI 146 PdSFBa 66 -NFECLVDPDDPCFEQELQWSLFSYETFEQCSELSHPLGSPEPY RIYGSTNGLICISDAILSLESPIHIWNPSVRKLRTLPM 146 PdSFBd 66 -NFECQRDDDDPYFKEELQWSLFSNVTFEESSKLSHPLGSTEHY VIYGSSNGLVCISDEIMNFDSPIHIWNPSVKKLRTTPI 146 PdSFBf 66 -NFERKDDPDDPYVEQEFQWSLFSKETLEECSKLSHPSGSTEHY VIYGSSNGLVCISDEILNFDSPIHIWNPSVKKFRTPPV 146 PcSFB9 66 -DVERQADPDDPYVKQELQWSLFSNETFEECSKLSHPLGSTEHY MIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTTSM 146 PsSFBc 66 -NFEWAVDPDDPYVKQELQWSLFSNETFEKCFELRHPLGSTEHY GIYGSSNGLVCISDEILNFDSPIHIWNPSIRKFRTPPM 146 ParSFBc 66 -NFERLVDPNDPYLKKEFQWSLFPKETFEECYKLSHPLGMTEHY GIYGSSNGLVCISDEILNFDSPIHIWNPSVRKFRALPM 146 PavSFB2 66 -NFERNDDPDDPYVKQEFHWSLFSNETFEECSKLSHPLGSTEHY VIYGSSNGLVCISDEILNFDSPLHIWNPSVRKLRTPPI 146 PavSFB5 66 -NVRRQVNPDDPYVTQEFQWSLFPNETFEECSKLSHPLGSTEHY GIYGSSNGLVCISDEILNFDSPILMWNPSVRKFRTAPT 146 PavSFB6 66 -NFERNDDPDDPYVEQEFQWSLFSNETFEECSKLSHPSGSTKHY VIYGSSNGLVCISEEILNFDSPIHIWNPSVKKFRTPPM 146 PavSFB9 66 -DVERQADPDDPYVKQELQWSLFSNETFEECSKLSHPLGSTEHY MIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTTSM 146 PavSLFL1-S1 64 DPNPKEKELAFSFLYLRNDYD-DAENN-VNCVVEDIKFPLTSGQ FIGLEVIESPSIIGHCDGVICLS----ACS--LVLCNPAINEIKLLPE 147 PavSLFL1-S2 64 DANTGEKELGFSFLYLRNDYD-DAEHN-VNFLVEDIKFPLSSGQ YIGLEVIESPYMAGHCHGIVCLS----DSSSNLVLCNPGIKEIKLLPK 149 PavSLFL1-S4 64 DTNSDEKELAFSFLYLRNDYD-DDEHN-VNFVVEDIKSPLSSGR FIGLEDVESPSILGHCNGIVCLS----PCSDNLLLCNPGIKEIKLLPK 149 PavSLFL1-S6 64 NTNSDEKELAFSFLYLRNDYD-DDKHN-VNFVVEDIKFPLSSGR CIGLEDVESPSILGHCNGIVCLS----PCSDNLVLCNPAIKEIKLLPK 149 PavSLFL2-S4 83 ATLFNPDSDQRDILLSSINLGSLVDDG---LEIENHVVPPPMR GYALSLEIAGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 163 PavSLFL3-S4 69 RTEHNKEELVFTFLNLHNDNESNADHNLINCNVEDLHFPHSMGLKSRGPFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 164 PmSFB1 66 -NFECAIDPNDPYIEEEVQWSLFSNETFEQCSKLSHPLGSTEHY VIYGSSNGLVCISDEILNFDSPIHIWNPSARKLKTPPI 146 PmSFB3 66 -SFECQVDLDDPYVGQELQWSLFCNETFELCSKLSHPLGSTEHY MIYGSSNGLVCISDEILNFDSPIHIWNPSIRKLRTPPL 146 PmSLF7 66 -NFERQVDPDDPYVEQKFHWSIFSNETFEECSKLSHPLGSTERY GIYGSSNGLVCISDEILNFDSPIHIWNPSVRKLRTPPM 146 PmSLFL1-Sf 64 DANSDEKELAFSFLYLRNDYD-DDEHN-VNFVVEDIKFPLSSGR FIGLEDVESPSILGHCNGIVCLS----PCSDNLVLCNPAIKEIKLLPK 149 PmSLFL2-S1 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHIVPPPMR GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167 PmSLFL2-S7 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHVVPPPMR GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167 PmSLFL2-Sf 87 ATLFNPDSNQRDILLSSLNLGSLVDDG---LEIENHVVPQPMR GYALSLEISGSCDGLICLNTFNSED---IVLCNPALEEYRVLPK 167 PmSLFL3-S7 59 RTEHNKEELVFTFLILRNDNEINADHNLINCKVEDLHFPRSMGLKSRGQFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 154 PmSLFL3-Sf 69 RTEHNKEELVFTFLILRNDNESNADHNLINCNVEDLHFPRSMGLKSRGQFIELPGLELGESVHIVGHCDGLFCLS----LYTGELVFYNPAIKEFRVLPQ 164 PhSLFv 66 -SIK-DEEEEFINILSFFS-GHDD-VLNPLFPDIDVSYMTSKCD CSFN--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPP 142 PiSLF1 66 -SIK-DEQEGFKDILSFFS-GHDD-VLNPLFPDVEVSYMTSKCN CTFN--PLIGPCDGLIALT-DSIIT----ILLNPATRNFRLLPP 142 PiSLF2 66 -AIK-DDEEEFINILSFFS-GHVD-VLNPLFPDMDVSYMTSKCD CTFN--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPA 142 PiSLF3 66 -AIK-DEQEEFRDILSFLS-GHDD-VLNPLFADIDVSYMTSKCN CAFN--PLIGPCDGLIALT-DTIIT----IILNPATRNFRLLPP 142 PiSLF3A SFETDEYNFYKSILSFLF-AKKDYDFKPISPDVKIPHLTTTAA CICH--RLIGPCNGLIVLT-DSLTT----IVFNPATLKYRLIPP 139 PiSLFL1 67 -TFR-EEPDLWKNVASFIY-CDDNNDHNNLFPDLDLSHLTSSYC SIFG--QLIGPCHGLIALS-DSIII----IILNPSTRKYVVLPP 144 PiSLFL2b 67 -SYR-EETEGFKNALSILSCGNDD-DLIHTISDLDLPYLTFTQR YLFN--KLVGPCNGLIVLT-DFEII----VLFNPATKIYMLIPP 144 PiSLFL2d 64 -SFK-EQ-EGFRNVMSFLVGGIGEDDLDPISPDVDVPYLSTTYS CICH--QLTGPCHGLILLT-DSTNL----VLLNPATRNYRLLPP 141 Pa AIK-DEEEEFINILSFFS-GHDD-VLNPLFPDIDVSYMTSKFN CTFN--PLIGPCDGLIALT-DSIIT----IILNPATRNFRVLPP 142 Pa SIK-DEEEEFINILSFFS-GNDD-VLNPLFPDIDVSYMTSKCD CTFT--PLIGPCDGLIALT-DTIIT----IVLNPATRNFRVLPP 142 PaF1 66 -AIK-DEEEEFINILSFFS-GYDD-VLNPLFPDIDVSYMTSNCN CTFN--PLIGPCDGLIALT-DTIIT----ILLNPATRNFRLLPP 142 NaDD1 66 -SFK-EEANQFKNVISFLF-GVDDVGFDPFLPDLEVPHLTTDYG SIFH--QLIGPCHGLIALT-DTITT----ILINPATRNFRLLPP 143 NaDD2 66 -SFKQEEPNLHKNVLSFLL-SEDTFNLKPISPDVEIPHLTNTNA SVFH--QLIGPCNGLIALT-DSLTT----ILFNPTTRIYRLIPP 144 NaDD3 66 -SIK-EDTGEFKNVLSFLS-GHDNGALNPLFPDIDVSYMASNCS CTFF--PLIGPCNGLIALT-DTITT----ILINPATRNFRLLPP 143 NaDD4 66 -SFK-EEANQFKNVISFLF-GVDDAGFDPLLPDLEVPHLTTDYG SIFH--QLIGPCHGLIALT-DSVQT----VLLNPATRHYRLLPP 143 NaDD5 66 -SFK-EEPNQFRSIMSFLSSGHDNYDLHHVSPDLDGPYLTTTSS CICH--RIMGPCHGLITLT-DSVTA----VLFNPGTRNHRLLQP 144 NaDD6 67 -SFR-IETEGFKNVLSIISSDDYN-DLNVVLQDLDLPYLTFTPN YHFN--ELVGPCNGLIVLTDDDDII----VLFNPATKNYMLLPP 145 NaDD7 67 -YLEIDA-EESIYYNGKN-----MLSVHCNDDSLKSVAPNTEYL DDYIGVNIAGPCNGIVCIG-SYRGI----VLYNPTLREFWELPP 142 NaDD8 66 -SFQ-EEPNKFRSIMSFLSSGQDNDDFYHVSPDLDVPFLTTTSS CIFH--RFTGPCHGLVVLT-DKVTA----VLFNPTSRNYRLLQP 144 NaDD9 70 -SYK-EEPNRFKSVLSFLSSGHDDDDLHPVSPDLDMQYMTTSSA CTCH--RIIGPCNGLIFLT-DKLNN----VLFNPTTRNYRLLTP 148 NaDD SIN-----RYKHVLSFISTKNDGDDLRPMSPDLDMSYLTSFNP GIGH--RLMGPCNGLIALT-DKVNA----VLFNPATRHYRLLKP 139 AhSLF1E 63 -YVRTPE-RDMFSFYNINSPELDELLPDLPNPYFKNIKFDYDYF YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143 AhSLF2 63 -YVRTPE-RDMFSFYNINSPELDELLPDLPNPYFKNIKFDYDYF YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143 AhSLF2C 66 -FLRPPEDEDVLSFHDVNSPELEQVAPNLSIPFLKDIRLRYNRP YFPEGVTLLGPCNGLLCIT-HAEFL----IFCCPTLREFKRLQP 147 AhSLF4 63 -YVRTPE-RDMFSFYDINSPELDELLPDLPNPYFKNIKFDYDYF YLPQRVNLMGPCNGLVCLA-YGDCV----LLSNPALREIKRLPP 143 AhSLF5 63 -YVRTPE-RDMFSFYNINSPKLEELLPDLPNPYFKNIKFDYDYF YLPQRVNLMGPCNGLICLA-YGDCV----LLSNPALREIKRLPP 143 AmSLFL 63 -YVRTPE-RDMFSFYNINSPKLEELLPDLPNPYFKNIKFDYDYF YLPQRVNLMGPCNGLICLA-YGDCV----LLSNSALREIKRLPP 143 AT2G VADEFYLLKRVHQVMRTLVLGSSVSVRILTPWEDTLYKVCQS SCDGLICLYNTYASN----IVVNPTTRWHREFPL *

3 MdFBX1 152 SSLLLPLP KGRFGLETVFKGLGFGYDCKAKEYKVVRIIENCDCEYSEGEESYYE RILLPHTAEVYTMTTNS 222 MdFBX2 152 SSLLLPLP KGRFGLETTFKGMGFGYDCKTKEYKVVRIIENCDCEYSEDGESYYE RILLPHTAEVYTTTANS 222 MdFBX3 152 SFLLLPSPL GGKFELETDFGGLGFGYDCRAKDYKIVRIIEN--CEYSDDERTYYH RIPMPHTAEVFTMATNY 221 MdFBX5 152 SSLLLPLP TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGKESYIE RILLPYTAEVYTTVANS 222 MdFBX6 152 SCLLLP-PP KGKFELETTFQALGFGYDCNSKDYKVVQIIEN--CEYSDDEQTFHH RIALPHTAEVYTTAANS 220 MdFBX7 152 SCLLVP-HP EGKFELETTFHGMGFGYDCKAKEYKVVQIIEN--CEYSDDGQTYQH CIAYPYTAEVYTTAANF 220 MdFBX8 154 SRLLLPLPRG KGKFGLETTVKGLGFGYDCKAKEYKVVRIIENYDCEYSDGEETYIE HTALPHTAEVYTTTANS 226 MdFBX9 157 SYLLLPSRP QGKFQLESIFGGLGFGYDCKAKDYKVVQIIEN--CEYSDDQQYYYH RIALPHTAEVYTMAANS 226 MdFBX SCLLLPLPGV KEKFGMETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE HIALPHTAEVYTMAANS 223 MdFBX SCLLLPSRP KGKFELETVFRALGFGYDCKAKEYKVVQIIEN--SEYSDDERTYYH RIPLPHTAEVYTTAANS 221 MdFBX SCLLVPSPP EGKFQLETIFEGLGFGYDYKAKEYKVVQIIEN--CEYSDDERRYYH RIALPHTAEVYTTTANS 222 MdFBX SCLLLP-PA EGKFELDTTFEALGFGYDCKGKEYKVVQIIEN--CEYSDDEQTFNH CTTLPHTAEVYTTVANS 217 MdFBX SCLLLPSPP KGKFELESSFQGMGFGYDSKAKEYKVVKIIEN--CEYSDYERTFSH RIALPHTAEVYVTTTNS 237 MdFBX SSLLLPLP TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSDGKESYIE RILLPYTAEVYTTAANS 222 MdFBX SCLLLPSRP TGKFQLESIFGGLGFGYDCKAKEYKVVQIIEN--CEYSDDQQYYYH RIALPHTAEVYTMAANS 226 MdFBX SCLLVP-HP EGKFELETTFHGMGFGYDCKANEYKVVQIVEN--CEYSDDEQTYQH CIAYPYTAEVYTTAANF 220 MdFBX SCLLLPLPGV KVKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE HIALPHTAEVYTMAANS 223 MdFBX SCLLLPSPP EGKFELETSFQALGFGYDSNAKEHKVVRIIEN--CEYSDEERTFYH RIALPHTAELYTATANS 221 MdFBX SCLLLPSPP EGKFQLETIFEGLGFGYDYKAKEYKVVQIIEN--CEYSDDERRYYH RIALPHTAEVYTATANS 229 MdSFBB3-alpha 152 SCLLLPSPP ERKFELETNFQALGFGYDCNAKEYKVVRIIEN--CEYSDDERTYYY RIALPHTAELYTTTANS 221 MdSFBB3-beta 152 SCLLQP-PP KGKFELETTFQALGFGYDCNAKEYKVVRIVEN--CEYSDDEQTFYH RIALPHTAEVYTTAANF 220 MdSFBB9-alpha 152 SSLLLPLP KGRFGLETVFKGLGFGYDCKAKEYKVVRIIENCDCEYSEGEESYYE RILLPHTAEVYTMTADS 222 MdSFBB9-beta 152 SPLLLPLP KGRFGLETTFKGMGFGYDCKSKEYKVVRIIENCDCEYSDDGESYYE RILLPHTAEVYTMTANS 222 PpSFBB1-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB2-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB3-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB4-alpha 152 SSLLLPLP TGKFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSEGKESYYE RILLPYTAEVYTTAANS 222 PpSFBB4-beta 152 SCLLLPSPP EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN--CEYSDDMRTFSH RIALPHTAEVYVTTTNS 221 PpSFBB4-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB5-alpha 152 SSLLLPLP TGRFGLETLFKGLGFGYDCKTKEYKVVRIIENCDCEYSEGKESYYE RILLPYTAEVYTTAANS 222 PpSFBB5-beta 152 SCLLLPSPP EGKFELESTFQGMGFGYDSKAKEYKVVKIIEN--CEYSDDERTFSH RIALPHTAEVCITTTNS 221 PpSFBB5-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB6-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB7-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB8-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSDDGETYIE HIALPYTAEVYTMAANS 223 PpSFBB9-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PpSFBBk-gamma 151 SCLLLPLPGV KEKFGLETTLKGLGFGYDCKAKEYKVVRIIDNYDCEYSEDGETYIE HIALPYTAEVYTMAANS 223 PdSFB1 147 STSINIKFS HVALQFGFHSGVNDYRAVRMLRTNQN ALAVEIYSLRTDS 194 PdSFBa 147 TTN-NIEFS YIDLHFGFHPGVNDYKAVRMMGIDKD AFAVEIYSLSTDS 193 PdSFBd 147 STSINIKFS HVALQFGFHSGVNDYRAVRMLRTNQN ALAVEIYSLRTDS 194 PdSFBf 147 STNINMKFS HVALQFGFHPGVNDYKAVRMMRTNKN ALAVEVYSLRTDS 194 PcSFB9 147 STNINIKFS HVALQFGFHPGVNDYKAVRMMRTNKN ALVVEVYSLRTDS 194 PsSFBc 147 STNINIKYS YVALQFGFHPRVNDYKIIRMMRTNKD AFTVEVYSLGTDS 194 ParSFBc 147 STNINIKFS CVALQFGFHPGVNDYKAVRMMRTNKS ALAVEVYSLKRDS 194 PavSFB2 147 STNISIKFS HVALQFGFHPEVNDYKVVRMMRTNKN TLAVEVYSLRRDR 194 PavSFB5 147 STNINLKFA YVALQFGFHHAVNDYKVVRMMRTNKD ALAVEVYSLRTDS 194 PavSFB6 147 STNINIKFS HVALQFGFHPGVNDYKAVRMMRTNKN ALAVEVYSLKTDS 194 PavSFB9 147 STNINIKFS HVALQFGFHPGVNDYKAVRMMRTNKN ALVVEVYSLRTDS 194 PavSLFL1-S1 148 SCLPDWWD CAVGFGYDPKSKDYKVSRIATYQAEI--DG LIPPPRVEIYTLSTDS 199 PavSLFL1-S2 150 SCLPDWWG CAVGFGYDPKSKDYKVSRIASYQAEIYGDG LIPRPRVEIYTLSTDS 203 PavSLFL1-S4 150 SGLPDWWG CAVGFGYDPKSKDYKVSRIASYQAEI--DG LIPPPRVEIYTLSTDS 201 PavSLFL1-S6 150 SGLPDWWG CAVGFGYDPKSKDYKVSRIASYQAEI--DG LIPPPRVEIYTVSTDS 201 PavSLFL2-S4 164 SCILLPPRVPRQVEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH PSKVEVYSLAADT 240 PavSLFL3-S4 165 SCLENAFS CTLGFGYDPKRKDYILLSVVSYGEEILDDER LVIHPPQAEIYTLSTNS 220 PmSFB1 147 STNINIKFS CVVLQFGFHPGVNDYKAVRMMRTNKN ALAVEVYSLRTNS 194 PmSFB3 147 SANINIKFS HVALQFGFHPGVNDYKAVRMMRTNKK ALAVEVYSLRTDS 194 PmSLF7 147 SANINVKFS HVALQFGFHPGLNDYKVVRMMRTNKN ALAVEVYSLRTDS 194 PmSLFL1-Sf 150 SGLPDWWG CAVGFGYDPKSKDYKVSRIASYQAEI--DG LIPPPRVEIYSLSTDS 201 PmSLFL2-S1 168 SCILLPPRVPRQFEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH PSKVEVYSLAADT 244 PmSLFL2-S7 168 SCILLPPRVPRQFEENEDDDYYEEDDDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH PSKVEVYSLAADT 244 PmSLFL2-Sf 168 SCILLPPRVPRQFEENEDDDYYEEDEDDEIESNPKCVGFGYDPNSKDYKVVRAAQFVSGVFTQH PSKVEVYSLAADT 244 PmSLFL3-S7 155 SCLEDACS CTLGFGYDPKRKDYVLLSIVSYGEEIFDDER LVIHPPQAEIYTLSTNS 210 PmSLFL3-Sf 165 SCLEDACS CTLGFGYDPKRKDYVLLSIVSYGEEIFDDER LVIHPPQAEIYTLSTNS 220 PhSLFv 143 SPFGCP KGYHRSVEG-VGFGFDTISNYYKVVRISEVYCEEADGYPGPKD SKIDVCDLSTDS 202 PiSLF1 143 SPFGCP KGYHRSVEG-VGLGLDTISNYYKVVRISEVYCEEAGGYPGPKD SKIDVCDLGTDS 202 PiSLF2 143 SPFGCP KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEADGYPGPKD SKIDVCDLSTDS 202 PiSLF3 143 SPFGSP KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEDGGYPGPKD SKIDAFDLSTDS 202 PiSLF3A CPFGIP RGFRRSISG-IGFGFDSDANDYKVVRLSEVYKG-----TCDKK MKVDIYDFSVDS 194 PiSLFL1 145 SPFGCP KGYHRSIEG-IGFGFDSIVNDYKVVRLSDVYWDPPTDYPGPRE PKVDIYDLSIDS 204 PiSLFL2b 145 SPFVCP KGFHRSFRGGVGFGFDSIVKDYKLVAISEVFKDSEWG-TDEKE QKVEVYDMRIDS 204 PiSLFL2d 142 SPFGIQ RGFYRSVAG-VGFGYDSVHKTYKVVRISEVYGEPPFNCPSVME WKGEVYNSSTDS 201 Pa SPFGCP KGYHRSVEG-VGFGLDTISNYYKVVRISEVYCEEAGGYPGPKD SKIDVFDLRTDT 202 Pa SPFGCP KGYHRSVEG-VGFGFDTISYYYKVVRISEVYCEEADGYPGPKD SKIDVCDLSTDS 202 PaF1 143 SPFACP KGYHRSIEG-VGFGLDTISNYYKVVRISEVYCEEADGYPGPKD SKIDVCDLVTDS 202 NaDD1 144 SPFGCP NGYHRSVEA-LGFGFDSIANDYKIVRLSEVFWDPLYDYPGPRE SKVDIYDLSIDS 203 NaDD2 145 CPFGTP PGFRRSISG-IGFGFDSIANDYKFVRISEVYKD-----PCEKD MKVEVFDMCTDT 199 NaDD3 144 SPFGCP NGYHRSVEA-LGFGFDSIANNYKVVRISEIFWNPVYDYPGPRE SKVDVYDLSIDS 203 NaDD4 144 CPFGCP KGYHRTIEG-VGFGFISILNDFKVVRISDVFWDPPYGYPEGRD SKVDIYELSTDS 203 NaDD5 145 SPFGSP LGFYRSIRG-IAFGFDSVANGHKIVRLAEVRGEPPFYCFTMRE WRVEVYDLSTDS 204 NaDD6 146 SPFVCS KGYHRSFIGGVGFGFDSIGNDYKFVRISEVFLDTYWG-PEERE QKVEVYDLRSDS 205 NaDD7 143 SILPPPPYLS SDKKLNYWMDMTMGIGFDPNTNDYKVVRILRPAHEYTFEDFDNHIR DVSKVEVYNLSTNS 212 NaDD8 145 SPFGSP LGFHRSING-IAFGYDSIANEYKIVRIAEVRGEPPFCCFSVRE WRVEIYELSIDS 204 NaDD9 149 SPFGCP LGFHRSINC-VGFGFDLIVNDYKIVRISEVRGEPPFYCDSMRE WKVEVYELRTDS 208 NaDD SPFDCP LGFYRSIDG-VGFGFDSIAKDYKIVRISVIHGDPPFYDFNMRE QKVEVYELSTDS 199 AhSLF1E 144 TPFANP EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN IYVYYSDTNS 195 AhSLF2 144 TPFANP EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN IYVYYSDTNS 195 AhSLF2C 148 CPYVSP KGFFDRIIGSGFGCTSMTDFKVVLIRSIWFDDVYDYS TYTLVHLYNSNTNS 204 AhSLF4 144 TPFANP EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN IYVYYSDTNS 195 AhSLF5 144 TPFANP EGHCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN IYVYYSDTNS 195 AmSLFL 144 TPFANP EGYCTDIIGYGFGNTCNDCYKVVLIESVGPEDHHIN IYVYYSDTNS 195 AT2G STFQRLDRY EHQVGSVSWAKLGFGKDKINGTYKPVWLYNSAELGGLNDDDEDYDDEDKNNISMICQGNNNTSTFCEVFDFTTKA *

4 MdFBX1 223 WKEIKIDVTSDTDP-YCIPYSCSVYLKGFCYWFAMDNGE YIFSFDLGDEIFHIIELPS RREFGFKFY---GIFL 292 MdFBX2 223 WKEIKIDISIETRW-YCIPYSCSVYLKGFCYWFAYDNGE YVFSFDLGDEIFHRIELPS RRESDFKFY---GIFL 292 MdFBX3 222 WKEIKIDISSKTYP-----CSCSVYLKGFCYWFTRDGEE FILSFDLGDERFNRIQLPS RRESGLEFY---YIFL 287 MdFBX5 223 WKEIKIDTSSDTDP-YCIPYSCSMYLKGFCYWFANDNGE YIFSFDLGDEIFHRIELPF RRESDFKFC---GLFL 292 MdFBX6 221 WKEIKIEISSQTYH-----CSCSVYLKGFCYWFASDSEE YILSFYLGDETFHIIQLPS RRESGFTFD---YIFL 286 MdFBX7 221 WKEIKINISSTTHP-----YPFSVYLKGFCYWFATDGEE CILSFDLGDEIFHRIQLPS KIESGFEFC---GLFL 286 MdFBX8 227 WKEIKINISSKILSLYSYPYSCSVYLKGFCYWLSSDDEE YICSFNLGDEIFDRIELPS RRESGFKLD---GIFL 297 MdFBX9 227 WRVIKIDISSETYH-----YSSSVYLNGFFYWFAIDGEK YILSFDLGDEIFHRIQLPS RRESDFEFS---NIFL 292 MdFBX WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 MdFBX WREIKIDISTKTYS-----CSCQVYLKGFCYWYATDAEE YILSFDLGDEIFHRIQLPS RRESGFKFY---YIFL 287 MdFBX WKEIKIEISSKTYQ-----CYGSEYLKGFCYWLANDGEE YILSFDLGDEIFHIMQLPS RRESGFKFY---NIFL 288 MdFBX WKEIKIDISSTTYS-----WSCSVYLKGFCYWYATDDEE YVLSFDLCDETFHRIQFPS RGESGFTFF---YIFL 283 MdFBX WRVIKIEISSDTYN-----CSCSVYLKGFCYWFASDDEE YILSFDLGDEIFHRIQLPR RKESGFLFY---DLFL 303 MdFBX WKEIKIDTSSDTDP-YCIPYSRSMYLKGFCYWFANDNGE YIFSFDLGDEMFHRIELPF RRESDFKFC---GLFL 292 MdFBX WRVIKIDISSETYH-----YSSSVYLNGYFYWFAIDGEK YILSFDLGDEIFHRIQLPS RIESDFEFS---NIFL 292 MdFBX WKEIKIDISSSTHP-----YPFSVYLKGFCYWFATDGEE CILSFDLGDEIFHRIQLPS KIESGFNFC---GLFL 286 MdFBX WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDLEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 MdFBX WKEIKIDISSTTYS-----CSRSVFMKGFCYWYATDGEE YILSFDLSDDKFHIIQLPS RRESGFRFY---YIFM 287 MdFBX WKEIKIEISSKTYQ-----CYGSEYLKGFCYWLANDGEE YILSFDLGDEIFHKIQLPS RRESGFKFC---NIFL 295 MdSFBB3-alpha 222 WKEIKIDISSTTYS-----CSRSVFMKGFCYWYATDGEE YILSFDLGDDTFHIIQLPS RRESGFRFY---YIFL 287 MdSFBB3-beta 221 WKEIKIDISIKTYH-----CSCSVYLKGFCYWFASDNEE YILAFYLGDETFHIIQLPS RRESGFTFD---YIFL 286 MdSFBB9-alpha 223 WKEIKIDVSSDTDP-YCIPYSCSVYLKGFCYWFACDNGE YIFSFDLGDEIFHIIELPS RREFGFKFY---GIFL 292 MdSFBB9-beta 223 WKEIKIDISIETRW-YCIPYSGSVYLNGFCYWFAYDNGE YVFSFDLGDEIFHKIDLPS RRESDFKFY---GIFL 292 PpSFBB1-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB2-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB3-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB4-alpha 223 WKEIKIDTSSDTDP-YCIPYSCSVYLKGFCYWFANDNGE YIFSFDLGDEIFRRIELPF RRESDFNFY---GLFL 292 PpSFBB4-beta 222 WRVIEIEISSDTYN-----CSCSVYLKGFCYWFASDDEK YVLSFDLGDEIFHRIQLPY RKESGFLFY---DLFL 287 PpSFBB4-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB5-alpha 223 WKEIKIDTSSDTDP-YCIPYSCSVYLKGFCYWFANDNGE YIFSFDLGDEIFRRIELPF RRESDFNFY---GLFL 292 PpSFBB5-beta 222 WRVIEIEISSDTYN-----CSCSVYLKEFCYWFASDDEE CILSFDLGHEIFHRIQLPC RKESGFLFC---DIFL 287 PpSFBB5-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB6-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB7-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB8-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBB9-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PpSFBBk-gamma 224 WKEITIDILSKILSSYSEPYSYSVYLKGFCYWLSCDVEE YIFSFDLANEISDMIELPF RGEFGFKRD---GIFL 294 PdSFB1 195 WTMIEAIPPWLKCT---WQHHQGTFFNGVAYHIIEKGPTFS VISFDPGSEEFEEFIAPD AICSLWRLCIHV 262 PdSFBa 194 WKRIEVIPPWLKCD---WQHYKGIFLNGVVYHLIEKGPTFS LMSFDSGNAEFEEFITPG AICRSRGLFIAV 261 PdSFBd 195 WTMIEAIPPWLKCT---WQHHQGTFFNGVAYHIIEKGPTFS VISFDSGSEEFEEFIAPD AICSLWRLCIHV 262 PdSFBf 195 WKMVEAIPPWLKCT---WQHHKGIFFNGVAYHIIEKGPIFS VISFDSGSEEFEEFIAPD TICTSWDLCIDV 262 PcSFB9 195 WKMIKAIPPWLKCT---WQPFKGTFFNGVAYHIILKGPIFS IMSFDSDSEEFEEFIAPD AICHSWELCIDV 262 PsSFBc 195 WKMIEAIPPWLKCT---WQHQMGTFSNGVAYHIIQKGPIFS VISFDSDSEEFQEFIAPD AICSSWGLCINV 262 ParSFBc 195 WKMIEAIPPWLKCT---LEHHRGTFFSGVAYHIIQKGPMLS IMSFDSGSEKFEEIIAPD AICSLWGLYIDV 262 PavSFB2 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIQKGPLFS IMSFDSGSEVFEEFIAPD AICNLWGLCIQV 262 PavSFB5 195 WKMIEAIPPWLKCT---WQHHRGTFFNGVAYHIIQKGPIFS IMSFDSGSEEFEEFIAPD AVCSSWGLCIDV 262 PavSFB6 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPICS IMSFDSGSDEFEEFIAPD AICSPSELCIDI 262 PavSFB9 195 WKMIKAIPPWLKCT---WQPFKGTFFNGVAYHIILKGPIFS IMSFDSDSEEFEEFIAPD AICHSWELCIDV 262 PavSLFL1-S1 200 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILLPDSFYMYEEGSAYAYEMSYIMYTDLRIIL 295 PavSLFL1-S2 204 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVILFDTGDEIFHRILFPDSFYMYEEGSSYAYEMSYIMYTDLRIIL 299 PavSLFL1-S4 202 WREIKNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILFPDSFYMYEEGSSYAYEMSYIMYTDLRIIL 297 PavSLFL1-S6 202 WREIRNNSLETDTTCFFP-DYFQMYFQGICYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHNLLFPDSFYMYEEGSSYAYEMSYLMYCDLRIIL 297 PavSLFL2-S4 241 WREIPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE RNVILSFDMSEEVFHGIALPE SGPDAYEYT---SIAV 309 PavSLFL3-S4 221 WRGIETHYLETETTYFWGNETFSTYFNGVFYWLGYEEKKDFVSFYDRLEEEKTQVIILFDTFDEVFHNMPLPDCFYEFP-----THEMS LTV 307 PmSFB1 195 WKMIEAIPPWLKCT---WQHHKGIFFNGVAYHIIEKGPIFS IMSFDSGSEEFEEFIAPD AICSSLGLCIHV 262 PmSFB3 195 WKMIEAIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPIFS IMSFDSGSEEFEEFIAPD AICNSWGLCIDV 262 PmSLF7 195 WKMIETIPPWLKCT---WQHHKGTFFNGVAYHIIEKGPLFS IMSFDSGSEEFEEFLAPD AICNSWGLCIDV 262 PmSLFL1-Sf 202 WREIKNNSLETDTTCFFP-DYFQMYFQGFCYWVGYEQPKQSVEYED---EEQKPMVIFFDTGDEIFHHILLPDNFYMYEEGSSYAYEMSYIMYTDLRIIL 297 PmSLFL2-S1 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE RNVILSFDMSEEVFHDIALPE SGPDAYEYT---SIAV 313 PmSLFL2-S7 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE RNVILSFDMSEEVFHDIALPE SGPDAYEYT---SIAV 313 PmSLFL2-Sf 245 WREVPVDIQPHGSLN----PSYQMYFKGFFYWIAYWTEE RNVILSFDMSEEVFHDIALPE SGPDAYEYT---SIAV 313 PmSLFL3-S7 211 WREIETHYLETETTYFWGNETFSAYFNGVFYWLGYEEKKEFVSFYDRLEEEKKQVIILFDTFDEVFHNMPLPDCFYEFP-----SHEMS LTV 297 PmSLFL3-Sf 221 WREIETHYLETETTYFWGNETFSAYFNGVFYWLGYEEKKEFVSFYDRLEEEKKQVIILFDTFDEVFHNMPLPDCFYEFP-----SHEMS LTV 307 PhSLFv 203 WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-TS MVILCFDMSTEMFHDMKMPD TCSRITHELYYGLVV 272 PiSLF1 203 WREL--DHV--QLPLIYWVPCSGMLYKEMVHWFATTD-ES MVILCFDMSTEMFRNMEMPD SCSPITHELYYGLVI 272 PiSLF2 203 WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-MS MVILCFDMSTEMFHDMKMPD TCSRITHELYYGLVI 272 PiSLF3 203 WREL--DHV--QLPLIYWLPCSGMLYKEMVHWFATTD-MS TVILCFDMSTEMFRNMKMPD TCS-VTHKQYYGLVI 271 PiSLF3A WREL--LGQ--DVPFVFWFPCAEILYKRNFHWFAFAD-D VVILCFDMNTEKFHNMGMPD ACHFDDGKS-YGLVI 262 PiSLFL1 205 WREL--SEV--EFPSIYYLPCSEMYYKEAVHWFSHID-MD VMILCFDIITEIFRTMKIPG DCTFLEIPR-YGLAI 273 PiSLFL2b 205 WRDL--NHVDQQLPTVYYYPCFERLYNGAFHWYAINDRFD HVILSFDISTEIFHSIKMPA TDKSSGGKK-YALIV 276 PiSLFL2d 202 WREL--DCVDQELPWPYNFAYSEIFYEGAFHWYAHKN-V VLILCFDVNTETFRTMEVPE PCASYDEKC-HSLLV 271 Pa WKEL--DHV--QLPLIYWLPCSGMLYKQMVHWFATTD-M MVILCFDISTEMFRNMKMPD TCCLITHELYYGLVI 271 Pa WREL--DHV--QLPSIYWVPCAGMLYKEMVHWFATTD-TS MVILCFDMSTEMFHDMKMPD TCSRITHELYYGLVI 272 PaF1 203 WREL--DHI--QLPLIYWVPCSGMLYMEMVHWFATTD-IS MVILCFDMSTEVFRNMKMPD TCTRITHELYYGLVI 272 NaDD1 204 WREL--DSE--QLPLIYWVPCAETFYKEAFHWFGTID-LS MVILCFDVSTEIFRNMKMPR TFI-FDNAQYPGLVI 272 NaDD2 200 WREL--HGQ--QLPMAFWTPCSEIIYNCAFHWFATAD-D VVILCFDMCAEKFYNMETPG TCHWFDGKC-YGLVI 267 NaDD3 204 WREL--DHV--QVPLIYWLPCSETLYNEVVHWFASTD-LS LVILCFDMCTEIFRNIKMPD TFI-FDNAEFYGLVI 272 NaDD4 204 WREL--EPV--QVPRVYWLPCSEMVYQEAVHWFATIE-E VVILCFDIVTETFRNMKMPD ACYSIKQSR-YGLIV 271 NaDD5 205 WREV--DNVDQHLPYVHWYPCAELFFKGASHWFGSTN-T AVILCFDMSTETFRNIKMPD TCHSKDRKC-YALVV 274 NaDD6 206 WRDL--NHVDQQLPTIFWNQCFEMLHNGAFHWYAVGD-LT YEILCFDFSTEIFRSMKMPE SCNAYDGKR-YSLAV 276 NaDD7 213 WRRIK-DLECL----VDTLHCSHVFFNGAFHWRR--YTKSD DYFIVSFNFSIESFQMIPSPE GLTDEGR---KSLFV 279 NaDD8 205 WREV--DNVDQQLPYVHWNPCAELFYKGASHWFGNTN-T VVILCFDMSTETFRNIKMPD TCHSKYRKR-YGLLV 274 NaDD9 209 WREL--DQVNLQLPYVHWNPCSDMFYSGASHWFGNAN-T VVILCFDLSTETFRNMKMPN TCHSRDEKC-YGLVV 278 NaDD WREL--DLLDQHLPNVDYYPCSEKFYNGASHWLGNDT-T LVILCFDMSTEIFRNIKMPS ACHSNDGKS-YGLTV 269 AhSLF1E 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY ADFILTFDIITEVFKEMAYPH CLAQFSNSF-LSLMS 269 AhSLF2 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY ADFILTFDIITEVFKEMAYPH CLAQFSNSF-LSLMS 269 AhSLF2C 205 WRITN-DVGTLSFKDLWDYPCSQRFFHGNLHWNAASYDYSS RKAILTFNLNTETFGQLEYPD YFKKLHETG-ICFTI 279 AhSLF4 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY ADFILTFDIITEVFKEMAYPH CLAQFSNSF-LSLMS 269 AhSLF5 196 WKHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY ADFILTFDIITEVFKEMAYPH CLAQFSNSF-LSLMS 269 AmSLFL 196 WRHIE-DDSTP-IKYICHFPCNELFFKGAFHWNANSTDIFY ADFILTFDIITEVFKEMAYPH CLAQFSNSF-LSLMS 269 AT2G WRFVVPASPYRILP-----YQDPVYVDGSLHWLTEGETTN VLSFDLHAETFQVVSKAP FLHHHDYSSRELI 282 * *......

5 MdFBX1 293 YNESITSYCSRYE--EDC---KLFEIWVMDD---DDGVKSSWTKLLTVGPFKDI---DYPLTLGKCDEVLMLGS-YGRAAFCNSS----IGNLKYLHIPP 376 MdFBX2 293 YNESVTSYCYRHE--EDC---ELFEIWVMDD---YDGVKSSWTKQLTIGPLKDI---DYPLTLWKCDEILMLGS-YGRAASCNSS----TGNLKYLHIPP 376 MdFBX3 288 CNESIASFCSRYDRSEDS---KSCEIWVMDD---YDGVKSSWTKLLVAGPFKGI---EKPLTLWKCDELFMIDT-DGRVISYNSS----IGYLSYLHIPP 373 MdFBX5 293 YNESVASYCSCYE--EDC---KLVETWVMDD---YDGVKSSWTKLLTVGPFKDI---ESPLKFWKCDEVLILSS-YGKATSYNSS----TGNLKYFHIPP 376 MdFBX6 287 LNESLASFCSPYNPSEDS---KLFEIWVMDD---YDGVKSSWTKLLTVGPFKGI---EYPLTLWKCDELLMLAS-DGRATSYNSS----TGNLKYLHIPP 372 MdFBX7 287 YNESITSYCCHNDPSEDS---KLFEIWVMDG---YGGVNSSWTKILTIGPSKDI---EYPLTFWKCDELLMFAS-GRRVTSYNSS----TGNLKDLHIPP 372 MdFBX8 298 YNESITYYCTSYE--ERS---RLFEIWVMDN---YDGVKSSWTKHLTAGPFKGI---EFPLTLRKHDELLMIAS-DGRATSYNSN----TGNLKYLHIPV 381 MdFBX9 293 CNKSIASFCSCCDPSDED--STLCEIWVMDD---YDAVKRSWTKLLTFGPLKDI---ENPFTFWKTDELLMVAA-GGRATTYNSS----TGNLNYLHIPP 379 MdFBX YNESLTYYCTSYE--EPS---TLFEIWVMGY---DDGFKSSWTKHLTAGPFKDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 MdFBX RNESLASFCSRYDRSDKS---ESCEIWVMHN---YDGVKSSWTKLLIIGPLQAI---GKPLTFWKSDELLMLAS-DERATSYNSS----TGNLKYLHIPP 373 MdFBX CNESIASFCCCYDPTNED--STLCEIWVMDD---YEGVKSSWTKLLTVGPLKGI--NENPLAFWKSDELLMVSC-DGRVTSYNCS----TKNLSYLHIPP 376 MdFBX RNESLTSFCSRYDRSGDS---QSCEIWVMDD---YDGVKSSWTKLLTVGPLQAI---EKPLTFWKSDELLMLAS-DGRTTSYNSS----TRNMKYIHIPP 369 MdFBX FNESIASFCSHYDKSDNSRILEILEIWVMDD---CDGVKSSWTKLQTLGPFKDN---ENLLTFWKSDELLMVTS-DNRVISYNSS----TGNLKYIHIPP 392 MdFBX YNESVASYCSCYE--EDC---KLVEIWVMDD---YDGVKSSWTKLLTVGPFKDI---ESPLKFWKCDEVLILSS-YGKATSYNSS----TGNLKYFHIPP 376 MdFBX YNKSIASFCSCCDPSDAD--STLCEIWVMDD---YDGVKRSWTKLLTFGPLKDI---ENPFTFWKTDELLMVAA-GGRATTYNSS----TGNLNYLHIPP 379 MdFBX YNESITSYCCRYDPSEDS---KLFEIWVMDG---YGGVKNSWTKLLTVGPFKGI---EYPLTFWKCNELLMVAS-SRRVTSYNSS----TGNLKDLHIPP 372 MdFBX YNESLTYYCTSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTVGPFKDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 MdFBX RNESLASFCSRYDRSEDS---ESCEIWVMDD---YDGIKRSWTKLLTIGPLQGI---KKPLTFWKSDELLMLDS-DGRATSYNSS----TGNLNYIHIPP 373 MdFBX CNESIASFCCCYDPKNED--STLCEIWVMDD---YGGVKSSWTKLVTVGPLKGI--NENPLAFWKSDELLMVSC-DGSVTSYNSS----TKNLSYLNIPP 383 MdSFBB3-alpha 288 RNESLASFCSRYDRSEDS---ESCEIWVMDD---YDGDKSSWTKLLNIGPLQGI---KKPLTFWRSDELLMLDS-DGRATSYNYS----TRNLKYLHIPP 373 MdSFBB3-beta 287 RNESLASFCSPYNPSEDS---KLFEIWVMDD---YDGVSSSWTKLLTVGPFKGV---EYPLTLWKCDELLMLAS-DGRATSYNSS----TGNLKYLHIPP 372 MdSFBB9-alpha 293 YNESITSYCSRYE--EDC---KLFEIWVMDD---YDGVKSSWTKLLAVGPFKDI---DYPLTLGKFDEVLMLGS-YGRAAFCNSS----TGNLKYLHIPP 376 MdSFBB9-beta 293 YNESVTSYCYRHE--EDC---ELFEIWVMDD---YDGVKSSWTKLLTIGPLKDI---DYPLTLWKCDEVLMLGS-YGRAASCNSS----TGNLRYLHIPP 376 PpSFBB1-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB2-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB3-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKCDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB4-alpha 293 YNESVASYCSRYE--EDC---KLLEIWVMDD---HDGVKSSWTKLLTVGPFKDI---ESPSTFWKCDEVLILSS-YGKATSYNSG----TENLKYLHIPP 376 PpSFBB4-beta 288 YNESIASFCSHYD-NDNAGILEILEIWVMDD---CDGVKSSWTKLLTLGPFEDN---ENLLTFWKSDELLMVTS-DKRAISFNSS----TGNLKYIHIPP 375 PpSFBB4-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFIDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB5-alpha 293 YNESVASYCSRYE--EDC---KLLEIWVMDD---YDGVKRSWTKLLTVGPFKDI---ESPSTFWKCDEVLILSS-YGKATSYNSS----TGNLKYLHIPP 376 PpSFBB5-beta 288 YNESIASFCSHYDESDNSGILKILEIWVMDD---CDGVKSSWTKLLTLGPFKGN---ENLLTFWKSDELLIVTS-DQRAISYNSS----TGNRKYIHIPP 376 PpSFBB5-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB6-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB7-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB8-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBB9-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWRHDELLMIAS-DGRAASYNSC----TGNFKYLHIPV 378 PpSFBBk-gamma 295 YNESLTYYCSSYE--EPS---TLFEIWVMDY---DDGFKSSWTKHLTAGPFTDM---EFPLTPWKRDELLMIAS-DGRAASYNSY----TGNFKYLHIPV 378 PdSFB1 263 YKEQICLLFGYYSCEEEG--MENIDLWVLQEK--RWKQLCPFIYDPLDDFYQIIGISTDNKLIMARKDFS-KGGVELQLGNYESK---QVLETGIKLAIV 354 PdSFBa 262 YKEQICLLFDFYCCEEEG--MEKIDFWVLEEK--QWTQLAPFVY--PSDSYKIIGISIDNELLLRKHDFSSVGLADLYLCNYESK---QVRQAGIKLAVM 352 PdSFBd 263 YKEQICLLFGYYSCEEEG--MENIDLWVLQEK--RWKQLCPFIYDPLDDFYQIIGISTDNKLIMARKDFS-KGGVELQLGNYESK---QVLETGIKLAIM 354 PdSFBf 263 YKEQICCLLKFYSCEEED--MDKIDLWVLQEK--RWKQLCPFVY-PFNYYYGTIGISIDNKLLMLKRDDI-RGQPDLHLCDYDSKPTQQVLETGIKLATM 356 PcSFB9 263 YKEQICLLFSCYSCEEED--MEKVDLWVLQEK--RWKLLCPFIY-PLGYDYRPIGISIDNKLSMQRKDYT-WGIADLHLCDYESK---QVQETGIKLAIM 353 PsSFBc 263 YKEQICLLFRFYGCEEEG--MEQVDFWVLQEK--RWNQLCPFIYP--RSCYRIMGISINNELILQKRDLN-KGVAYLYLCNYKSK---QVLETGITLAIV 352 ParSFBc 263 YKEQICLLFICYGCEEEG--MEKADLWVLQEK--RWKQLSPFI PavSFB2 263 YKEQICLLSGFYGCEEEG--MEKIDFWVLQEN--RWKQLCPFIYDPLDYCHRIIGISIDNELLMEREDFL-RGVGYLHLCNYESK---QVLETGIELAVM 354 PavSFB5 263 YNDQICLLSGFYGCEDEG--LDKIDLWVLQEK--QWKELCPVIFPPLGDCDRIIGISIGIELLMEKKDFD-KGVGELYLCNYESK---QVLQTGIKLAVM 354 PavSFB6 263 YKERVCLLFSFYSCDEEG--MVPNDLWVLQEK--RWKQLCPFIY-PAG-SYGTIGITIDNKLLMVRRDFL-RGAGDLCLCNYESK---QVFETGIELAVM 352 PavSFB9 263 YKEQICLLFSCYSCEEED--MEKVDLWVLQEK--RRKLLCPFIY-PLGYDYRPIGISIDNKLSMQRKDYT-WGIADLHLCDYESK---QVQETGIKLAIM 353 PavSLFL1-S1 296 WNGSIALFGINRFSALPE----SYGVWVLDD---FDGANGSWTKHLTFDPLEG--I-KRVLEILKSDEILMVTE-DGDIVSYNVA----IEKLKNLPMN- 379 PavSLFL1-S2 300 WNGSIALFGFNRFSAFPD----SYGIWVLAD---FDGAKGSWTKHLTFEPLVA--I-KRVLEFWKSDEILMVTE-DGDIVSYNLA----TEKLKNIPIN- 383 PavSLFL1-S4 298 WNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWIKHLTFEPLMG--I-KRVLEFWKSDEILMVTEEDGDIVSYSLE----TEKLKNLPMN- 382 PavSLFL1-S6 298 CNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWTKHLTFEPLMG--M-KRVLEFWRSDEILMVTE-DGDIVSYNLA----TEKLKNLPMN- 381 PavSLFL2-S4 310 WKDSLVLLTYPVENEAPK----TIDLWVLDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TLKLKHVPRHG 396 PavSLFL3-S4 308 WNESIALFGFYRCEFET------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLALWR-NEVLLVDR-DGRIFSYNLD----TENLKYLPVHG 387 PmSFB1 263 YKEQICLLSGFYGSEEED--MDKIDLWVLQEK--RWKQLCPFIF-PLDHCHRTIGFSADNELLMERRDFI-KGITHLCLCNYESK---QVLETGIRLAVM 353 PmSFB3 263 YKEYICLLFSFYSPQEDG--MGKKDLWVLQEK--RWKQLSPFMY-PFDCCS-TIGIRIDNELLMEIRDFS-RGVGHLHLCNYESK---QVLETGIELAVV 352 PmSLF7 263 YKEQICLLFTFYDCEEED--MEKSDFWVLQEK--RWKQLSPFIY-PSN-CYSTMGISIDNELLMQRRDHI-KGGADLYLCNYESK---QVLETGLRLGTV 352 PmSLFL1-Sf 298 WNGSIALFGFNRFSVFPD----SYGVWVLDD---FDGAKGSWTKHLTFEPLMG--I-KRVLEFWKSDEILMVTEEDGSIVSYNLE----TETLKNVPMN- 382 PmSLFL2-S1 314 WKDSLVLLTYPVENEAPK----TLDLWVFDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 400 PmSLFL2-S7 314 WKDSLALLTYPVENEAPK----TLDLWVLDEDL-KGA-KGLWTKHLAIGPLEKG--VEAPLVFWKDKELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 400 PmSLFL2-Sf 314 WKDSLVLLTYPVENEAPK----TLDLWVLDEDL-KGATKGLWKKHLAIGPLEKG--VEAPLVFWKDEELLMVTT-NGDVVNYSLD----TQKLKHVPRHG 401 PmSLFL3-S7 298 WNESIALFGFYRCEFEP------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLALWRRNEVLLVDR-DGRIFSYNFD----TENLKYLPVHG 378 PmSLFL3-Sf 308 WNESIALFGFYRCEFEP------FEVWVMDE---FDG----WTKHLSVVPKVDQEV-DIPLAIWRRNEVLLVDR-DGRIFSYNFD----TENLKYLPVHG 388 PhSLFv 273 LCESFTLIGYSNPISSIDPVEDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQSRSGL-LISYDLN----SGEAKELNLHG 359 PiSLF1 273 LCESFTLIGYSNPISSIDPVKDKMHIWVMMEY----GVSESWIMKYTIK-PLSI---ESPLAVWKKNILLLQSRSGR-LISYDLN----SGEAKELNLHG 359 PiSLF2 273 LCESFTLIGYSNPISSTDPAHDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQCRSGL-LISYDLN----SGEAKELNLHG 359 PiSLF3 272 LCESFTLIGYPNPVSPIDPAHDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKKNILLLQSRSGL-LISYDLN----SGQAKELNLHG 358 PiSLF3A LFKCMTLICYPDPMP-SSPTEKLTDIWIMKEY----GEKESWIKRCSIR-LLP----ESPLAVWKDEILLLHSKMGH-LIAYDLN----SNEVQELDLHG 347 PiSLFL1 274 LNECLTLISYPDPMCSDEPIEELIYIWIMKEY----GESESWIKKYTIK-PLPI---ESPLAIWKDHLLLLQSISGIILFSWDLN----SNEVKEFELHG 361 PiSLFL2b 277 LNESLTLICYPNPDCEMDPSKDSMDIWIMEEY----GVYESWTKKYIIK-PLPI---ESPLAIWRDYLLLLQSKSGL-LVSYDLS----SNEVKEFDLHG 363 PiSLFL2d 272 LDEFLTLFCYPDPRRESSPIQETIEIWTMQEY----RVNESWIKKHTIK-SPPI---ESPLAIWKDRLLLFQDKSGI-LISYDLN----SDEVKEFKLDG 358 Pa LCESFTLIGYSNPISSIDPARDKMHIWVMMEY----GVSESWIMKYTIR-PISI---KSPLAIWKNNILLLQNRSGI-LISYDLN----SGEAKEFNLHG 358 Pa LCESFTLIGYSNPISSIDPVEDKMHIWVMMEY----GVSESWIMKYTIR-PLSI---ESPLAVWKNHILLLQSRSGL-LISYDLN----SGEAKDLNLHG 359 PaF1 273 LCDSFTLIGYSNPIGSIDSARDKMHIWVMMEY----GVSESWIMKYTIK-PLSI---ESPLAVWKNNILLLQSRSGL-LISYDLN----SGEAKELNLHG 359 NaDD1 273 LSESLTLICYPNPIS-IDHIQEVTRIWVMKEY----GVSESWILKDTIR-LPPI---EYPLDIWKNNLLLFQSKSGL-LISYNLK----SDEVKELKLNG 358 NaDD2 268 LYKSLTLICYPDPMS-TDPTEDLMDIWIMKEY----GKKESWIKKCSIG-PLPI---ESPLAVWKDDLLLFQTKSGY-LIAYDLN----SDEVKEFNSHG 353 NaDD3 273 LSESLTLICYPNPIS-INPIQELTHIWVMKEY----GVSESWFLKDTIR-PPPI---ERPLDVWKNNIILFESKSGL-LVSYKLN----SNEVEELKLHG 358 NaDD4 272 LNESLALICYPDPRCAVDPTQDFIHIWLMEEY----GVSETWIKKYTIQ-SLPI---ESPLAVWKDHLLLLQSKIGQ-LISYDVN----SDEMKEFDLHG 358 NaDD5 275 MNDSLTLICYPYPGCEIDPAIDFMEIWEMKEY----GVNETWSKKYTIT-PLAI---NSPLAIWKEHILSLQSISGH-LISYDLN----SDEVKELDLHG 361 NaDD6 277 VNESLTLICYPSPDSEIDQTQNTMDIWIMMEY----GVNESWTKKYIIS-PLPI---ESPLTIWRDHLLLLQSKTGQ-LISYNLR----SNEVKEFDLRG 363 NaDD7 280 LSESLALICFTENYPREMLVHQSIDIWVMKKY----GVRESWIKEFTVG-PMLI---KIPLSVWKNDTELMIESNNGKLMSCNLL----SQATKDLDMSG 367 NaDD8 275 MNDSLTLISYPYPGCEIDSAIDFMEVWVLKEY----GVNESWSKNYTIT-PLAI---ESPLAIWKDRLLLLQSISGH-LISYDLN----SGEVKELNLYG 361 NaDD9 279 LNEYLTLICYPYPGKVIDPLKDFMDIWMMKDY----GVNESWIKKYTIT-PLSI---ESPLAVWKDHLLLLQSRKGF-LVSYDLK----SKEVKEFNFHG 365 NaDD LNECLTLICYTYSSAVNDQAENLIDVWIMKEY----DVNESWIKKYTIIRTLSI---KSPLAVWKDHLLLIQTKNGL-LISYDLN----SDEVKQYNLHG 357 AhSLF1E 270 LNECLAMVRYKE----WMEEPELFDIWVMKQY----GVRESWTKQYVIG-PQVV---VCSHVCWKSDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353 AhSLF2 270 LNECLAMVRYKE----WMEDPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNKIEKLPIYA 353 AhSLF2C 280 INNCFAIILYKD----SKEEPQPLDIWVMKKY----GFGESWTKQFTVG-PYQV---VSCILPWKNDEWLFVESSDGQLATCALH----TNEFRRLPIYG 363 AhSLF4 270 LNECLAMVRYKE----WMEEPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353 AhSLF5 270 LNECLAMVRYKE----WMEEPELFDIWVMNQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353 AmSLFL 270 LNECLAMVRYKE----WMEEPELFDIWVMKQY----GVRESWTKQYVIG-PQVV---VCSHVCWKNDECLIVEDGNGQLVSCAFR----TNEIKKLPIYA 353 AT2G MCNLDDRLCVSEKMWPNQ------VIWSLDSDHKTWKEIYSIDLNITSSLFGSNGFALRPLGVFDKDKLLFCEPEYGDQLLTHDP------KTKSYEFDY *

6 MdFBX1 377 IIN-----WMIDYVKSIVPVK MdFBX2 377 IIN-----WMIDYVKSIVPVK MdFBX3 374 IINRVIDSQALIYVESIVPIK MdFBX5 377 IIN-----WMIDYVETIVPVK MdFBX6 373 ILNKVVDFEGLIYVKSIVPLN MdFBX7 373 IMHQVTDLEALIYEESLVPIK MdFBX8 382 IIYRN---RVIDYAKSIVPVKRVEGKVPFSPI MdFBX9 380 ILNEVRDFEALIYMESIVPVK MdFBX IINEN---RVVDYVKSIILVN MdFBX ILNRVVDFQALIYVKSIVSFK MdFBX IVNEVRDFQAVIYVESIVPVK MdFBX ILNTVVDFQALTYVESIVPLK MdFBX IINKITGFEALIYVESIVSVKRVEGKVPFSPI MdFBX IIN-----WMIDYVETIVSVK MdFBX ILNEVRDFEALIYVESIVPVK MdFBX IIHQVTDLQAFIYEESLIPIK MdFBX IINEN---RVVDYVKSIVLVN MdFBX ILNRVVDFEVLIYVKSIVHVK MdFBX ILNEVRDFQAVIYVESIVSVK MdSFBB3-alpha 374 ILNRVVDFEVLIYVKSIVHVK MdSFBB3-beta 373 ILNKVVDFEGLIYVKSIVPLK MdSFBB9-alpha 377 IIN-----WMIDYVKSIVPVK MdSFBB9-beta 377 IIK-----WMMDYVKSIVPVQ PpSFBB1-gamma 379 IINQN---RVVDYVKSIILVN PpSFBB2-gamma 379 VINQN---RIVDYVKSIILVN PpSFBB3-gamma 379 IINQN---RVVDYVKSIILVN PpSFBB4-alpha 377 IIN-----WMIDYVETIVPVK PpSFBB4-beta 376 IMNKVTDFEALIYVESFVSVK PpSFBB4-gamma 379 IINQN---RVVDYVKSIILVN PpSFBB5-alpha 377 IIN-----WMIDYVETIVPVK PpSFBB5-beta 377 IINKITDLEALIYVESIVSIK PpSFBB5-gamma 379 VINQN---RIVDYVKSIILVN PpSFBB6-gamma 379 VINQN---RIVDYVKSIILVN PpSFBB7-gamma 379 IINQN---RVVDYVKSIILVN PpSFBB8-gamma 379 IINQN---RVVDYVKSIILVN PpSFBB9-gamma 379 IINQN---RVVDYVKSIILVN PpSFBBk-gamma 379 VINQN---RIVDYVKSIILVN PdSFB1 355 RYGESEFLFAMTYVESLLLLN PdSFBa 353 EYGHHELFFATTYIESLLFLNKSLKRDV PdSFBd 355 RYGESEFLFAMTYVESLALLNN PdSFBf 357 KYGEIEFLFSLSYIESLVLLNTY PcSFB9 354 KYDEIEFLFSITYIKSLVLLNND PsSFBc 353 TYDDIEFLFSITYIQSLVLLNNY ParSFBc PavSFB2 355 KYGEIEFSYAITYIESLVLLDKY PavSFB5 355 KYDEIEFVFAITYTESLVLLNNY PavSFB6 353 KYGEIELLFAITYIESLALLNKY PavSFB9 354 KYDEIEFLFSITYIKSLVLLNND PavSLFL1-S SSSD--FETIVYVNSLVSIIGRHQA PavSLFL1-S SPSD--FETVVYVNSLVPITGGNKLESADI PavSLFL1-S SPSD--FETILYVNSLVPITGGNKLES PavSLFL1-S SLSD--FETIVYVNSLVSITRGNKLESVDI PavSLFL2-S4 397 LGEPTN-IQAVPYVNSIVSIKPGNKIESI PavSLFL3-S4 388 VSRGD--FQAVVCVNSIVSVKCDNKFETKDY PmSFB1 354 KYGDIEFLFAITYIESLVLSN-Y PmSFB3 353 KYGEIEFLFALTYIESLLLLNNYIADV PmSLF7 353 TYGEIEFLFSVTYIETLVLLNSLQY PmSLFL1-Sf 383 -SPSD--FETILYVNSLVPITGGNKLGSVDM PmSLFL2-S1 401 LGEPTN-IQAVPYVNSIVSIKPGNKIESI PmSLFL2-S7 401 LGEPTN-IQAVPYVNSIVSIKPGNKIESI PmSLFL2-Sf 402 LGEPTN-IQAVPYVNSIVSIKPGNKIESI PmSLFL3-S7 379 ASRGD--FQAVVCVNSIVSVK PmSLFL3-Sf 389 ASRGD--FQAVVCVNSIVSVK PhSLFv 360 FPDTLS---VKVYKECLTSIPKG-SEYSTKVQKF PiSLF1 360 FPDSLS---VIVYKECLTSIPKG-SEYSTKVQKF PiSLF2 360 FPDSLS---VKVYKECLTSIPKG-SEYSTKVQKF PiSLF3 359 FPDSLS---VIVYKECLTSIQNG-SEYSTKVQNF PiSLF3A YPESLR---IIIYRESLTAIPRN-NDC-IELQNFRCN- 379 PiSLFL1 362 HLECMR---AVIYKESLTTIPRV-GEHSPQVQQF PiSLFL2b 364 YPKSLR---VLVYQESLISIPKRRCEHGTKFKIC PiSLFL2d 359 YPATLR---VIIYKESLTPIPKG-STQVQNF Pa FPGSLS---VIVYKECLTSIPKG-SEFSTKVQKF Pa FPDSLS---VKVYKECLTSIPKG-SEYSTKVQKF PaF1 360 FPDSLS---VIVYKECLTSIPKG-SEFSTEVQIF NaDD1 359 FPGSMS---VKVYKESLTSIPRG-LKL NaDD2 354 FPTSLR---VIVYKESLTPIPRN-GDG-TVVQLF NaDD3 359 CPGSLS---VKVYKESLTSIPSG-SEHSTKVQFF NaDD4 359 FPKSLR---VIVFKESLTSIPSG-SEHGTRVQKF NaDD5 362 WPESLR---VTIYKESLTLIPKG-SEH NaDD6 364 YPESLR---AIVYKESLISVPK------TKTRAW NaDD7 368 VPDTLE---AIVCKESLISIKREREKWS NaDD8 362 WPKSLK---ALVYKESLVLIPNE-SEDSPPEEIYLEKI 395 NaDD9 366 WPKSLR---ATVYKESLTLLPKE-SEHNKQVQF NaDD WPESLR---ATIYKECLTLIPKG-SEHPTEVKIF AhSLF1E 354 VEETLR---VLIVDESLISLNRVLN--F AhSLF2 354 VEETLR---VLIVDESLISLNRVLN--L AhSLF2C 364 VEKTMR---AMIYKESLISLNQVYINLFNKLLHGW AhSLF4 354 VEETLR---VLIVDESLISLNRVLN--F AhSLF5 354 VEETLR---VLIVDESLISLNRVLN--F AmSLFL 354 VEETLR---VLIVDESLISLNRVLN--F AT2G RFFSPTTALPLCYFQSLISIL


Download ppt "MdFBX1 1 ----------------MSLVCESETPEDQLVEILSWLRPKSLMRFKCIRKSWCTIINSSSFVAKHLSNSIDNKLSSSTCILLNR--------------CQ 70 MdFBX2 1 ----------------MSQVRECETPEDKVVEILSKLPPKSLIRFKCIRKSWCTIINSPSFVAKHLRISMDNKLSSTTCILLNR--------------CQ."

Similar presentations


Ads by Google