Presentation is loading. Please wait.

Presentation is loading. Please wait.

The Chemistry of Villin Gary Benz and Claudia Winkler.

Similar presentations


Presentation on theme: "The Chemistry of Villin Gary Benz and Claudia Winkler."— Presentation transcript:

1 The Chemistry of Villin Gary Benz and Claudia Winkler

2 The Chemistry of Villin Villin is a protein Proteins are macromolecules (polymers) formed by a defined sequence of small similar molecules (monomers) of amino acids Amino acids are organic compounds containing at least one amino group (NH 3 ) and one carboxyl group (-COOH). 20 different amino acids make up all proteins

3 The amino-acid alphabet Biologists represent each amino acid with a capital letter For instance: –D=Aspartic Acid, E=Glutamic Acid, F=Phenylalanine, K=Lysine, A=Alanine, V=Valine, F=Phenylalanine All amino acids are made of 4 elements: Carbon, Hydrogen, Oxygen, Nitrogen. Two also contain Sulfur.

4 Villin’s Single Chain Biologists describe the sequence of amino acids that make villin as: –DEDFKAVFGMTRSAFANLPLWKQQNLK KEKGLFMLS –Although villin is made of a chain of 36 letters, only 16 different letters are needed to describe villin –In the next slides we shall look at the individual amino acids that make up villin

5 D – Aspartic Acid NameInfoLooks Aspartic acid, Letter: D Abbreviation: Asp 4 oxygen 4 carbon 6 hydrogen 1 nitrogen

6 E – Glutamic Acid NameInfoLooks Glutamic acid Letter: E Abbreviation: Glu 5 carbon 8 hydrogen 4 oxygen 1 nitrogen

7 F – Phenylalanine NameInfoLooks Phenylalanine Letter: F Abbreviation: Phe 9 carbon 11 hydrogen 1 nitrogen 2 oxygen

8 K – Lysine NameInfoLooks Lysine Letter: K Abbreviation: Lys 6 carbon 14 hydrogen 2 nitrogen 2 oxygen

9 A – Alanine NameInfoLooks Alanine Letter: A Abbreviation: Ala 3 carbon 7 hydrogen 1 nitrogen 2 oxygen

10 V – Valine NameInfoLooks Valine Letter: V Abbreviation: Val 5 carbon 11 hydrogen 1 nitrogen 2 oxygen

11 G – Glycine NameInfoLooks Glycine Letter: G Abbreviation: Gly 5 carbon 11 hydrogen 1 nitrogen 2 oxygen

12 M – Methionine NameInfoLooks Methionine Letter: M Abbreviation: Met 5 carbon 11 hydrogen 1 nitrogen 2 oxygen 1 suphur

13 T – Threonine NameInfoLooks Threonine Letter: T Abbreviation: Thr 4 carbon 9 hydrogen 1 nitrogen 3 oxygen

14 R – Arginine NameInfoLooks Arginine Letter: R Abbreviation: Arg 6 carbon 14 hydrogen 4 nitrogen 2 oxygen

15 S – Serine NameInfoLooks Serine Letter: S Abbreviation: Ser 3 carbon 7 hydrogen 1 nitrogen 3 oxygen

16 N – Asparagine NameInfoLooks Asparagine Letter: N Abbreviation: Asn 4 carbon 8 hydrogen 2 nitrogen 3 oxygen

17 L – Leucine NameInfoLooks Leucine Letter: L Abbreviation: Leu 6 carbon 13 hydrogen 1 nitrogen 2 oxygen

18 P – Proline NameInfoLooks Proline Letter: P Abbreviation: Pro 5 carbon 9 hydrogen 1 nitrogen 2 oxygen

19 W – Tryptophan NameInfoLooks Tryptophan Letter: W Abbreviation: Trp 11 carbon 12 hydrogen 2 nitrogen 2 oxygen

20 Q – Glutamine NameInfoLooks Glutamine Letter: Q Abbreviation: Gln 5 carbon 10 hydrogen 2 nitrogen 3 oxygen

21 Elements Carbon (C), Hydrogen (H), Oxygen (O), Nitrogen (N) and Sulfur (S) are the only chemical elements that make up all villin’s amino acids. We shall review some of their properties in the next pages.

22 Carbon (Latin: carbo, charcoal) Carbon, an element of prehistoric discovery, is very widely distributed in nature. It is found in abundance in the sun, stars, comets, and atmospheres of most planets. Carbon is the source of energy for life through carbohydrates, just like a burning log is a source of energy to a cold room. Atomic number 6 Atomic Symbol C Atomic mass u Electron Configuration [He]2s 2 2p 2

23 Hydrogen (Greek: hydro, water, and genes, forming) Hydrogen is the most abundant of all elements in the universe. The heavier elements were originally made from Hydrogen or from other elements that were originally made from Hydrogen. Used in rocket fuel. Atomic number 1 Atomic symbol H Atomic mass u Electron Configuration 1s 1

24 Oxygen Greek: oxys, sharp, acid, and genes, forming; acid former) Oxygen is the third most abundant element found in the sun. Oxygen is vital to the respiration of living organisms. Oxygen is responsible for the bright red and yellow- green colors of the Aurora. Essential element for combustion (i.e. burning). Atomic number 8 Atomic symbol O Atomic mass u Electron Configuration [He]2s 2 2p 4

25 Nitrogen (Latin Nitrum, Greek. Nitron, native soda; genes, forming). Nitrogen gas (N 2 ) makes up 78.1% of the Earth’s air, by volume. Nitrogen is found in all living systems as part of the makeup of biological compounds. Ammonia (NH 3 ) is the most important commercial compound of nitrogen, with a very pungent smell, used in cleaning supplies. Atomic number 7 Atomic symbol N Atomic mass Electron Configuration [He]2s 2 2p 3

26 Sulfur (Sanskrit, sulvere; Latin sulpur) Known to the ancients; referred to in Genesis as brimstone. Sulfur occurs native in the vicinity of volcanoes and hot springs. It is widely distributed in nature in various minerals (iron pyrites, galena, sphalerite, cinnabar, stibnite, gypsum, epsom salts, celestite, barite, etc.) Sulfur is found in meteorites. Atomic number 16 Atomic symbol S Atomic mass32.6 Electron Configuration [Ne]3s 2 3p 4 Yellowstone hot springs

27 Molecules, Bonds Atoms are bonded together to form molecules and molecules are bonded together to form macromolecules. The next slides shows some characteristics of chemical bonds.

28 Chemical Bonds

29 Peptide Bond Amino acids join together via a special bond called “peptide bond”. In a peptide bond, two molecules (amino acid 1 and amino acid 2) are joined together with the accompanying removal of a molecule of water.

30 Activity Knowing that villin is made of the following sequence of amino acids –DEDFKAVFGMTRSAFANLPLWKQQNLKKEKGLFMLS Compute the molar mass of villin. Compute the percentage by number of each atom component. Compute the percentage by mass of each atom component. (Remember that amino acids are joined together through peptide bonds….) Lesson Plan


Download ppt "The Chemistry of Villin Gary Benz and Claudia Winkler."

Similar presentations


Ads by Google