Presentation is loading. Please wait.

Presentation is loading. Please wait.

Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK.

Similar presentations


Presentation on theme: "Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK."— Presentation transcript:

1 Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK Q R RGRDGI QYPHLFFAALALALL DPF L PLA VDYR 51 100 Maize MS45 protein PVKHELAPYGEVMGSWPRDNASRLRRGRLEFVGEVFGPESIEFDLQGRGP Rice NP_912416 PVRHELAPYREVMARWPRDNGSRLRHGRLEFVGEVFGPESIEFDRHGRGP Consensus PV HELAPY EVM WPRDN SRLR GRLEFVGEVFGPESIEFD GRGP 101 150 Maize MS45 protein YAGLADGRVVRWMGEEAGWETFAVMNPDWSEEVCANGVNSTTRKQHEKEE Rice NP_912416 YAGLADGRVVRWMGEDAGWETFAVMSPDWSEKVCANGVESTTKKQHEMER Consensus YAGLADGRVVRWMGE AGWETFAVM PDWSE VCANGV STT KQHE E 151 200 Maize MS45 protein FCGRPLGLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRF Rice NP_912416 RCGRPLGLRFHGETGELYVADAYYGLMSVGPNGGVATSLAREVGGSPVNF Consensus CGRPLGLRFHGETGELYVADAYYGLM VG GGVA S ARE G P F 201 250 Maize MS45 protein ANDLDVHRNGSVFFTDTSMRYSRKDHLNILLEGEGTGRLLRYDPETSAVH Rice NP_912416 ANDLDIHRNGSVFFTDTSTRYNRKDHLNVLLEGEGTGRLLRYDPETKAAH Consensus ANDLD HRNGSVFFTDTS RY RKDHLN LLEGEGTGRLLRYDPET A H 251 300 Maize MS45 protein VVLKGLVFPNGVQISEDHQFLLFSETTNCRIMRYWLEGPRASEVEVFANL Rice NP_912416 VVLSGLVFPNGVQISDDQQFLLFSETTNCRIMRYWLEGPRAGQVEVFADL Consensus VVL GLVFPNGVQIS D QFLLFSETTNCRIMRYWLEGPRA VEVFA L 301 350 Maize MS45 protein PGFPDNVRSN---GRGQFWVAIDCCRTPAQEVFAKRPWLRTLYFKFPLSL Rice NP_912416 PGFPDNVRLSSGGGGGRFWVAIDCCRTAAQEVFAKRPWLRTLYFKLPLTM Consensus PGFPDNVR G G FWVAIDCCRT AQEVFAKRPWLRTLYFK PL 351 400 Maize MS45 protein KVLTWKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGSKLW Rice NP_912416 RTLGKMVSMRMHTLVALLDGEGDVVEVLEDRGGEVMRLVSEVREVGRKLW Consensus L RMHT ALLDGEG VVEVLEDRG EVM LVSEVREVG KLW 401 430 Maize MS45 protein IGTVAHNHIATIPYPLED------------ Rice NP_912416 IGTVAHNHIATIPYPLEEQSSSSSSNVLGD Consensus IGTVAHNHIATIPYPLE Maize MS45 protein MEEKRKLQWRRGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYRPV Arabidopsis NP_974462 MEKKG--QHGTYESMMTHHPILCIIALSVLFIAIDPFHMSPIGGREFKPV Consensus ME K Q P L AL DPF SP PV Maize MS45 protein KHELAPYGEVMGSWPRDNASRLR-RGRLEFVGEVFGPESIEFDLQGRGPY Arabidopsis NP_974462 KHEVAPYKEVMGSWPRDNLSRLGNHGKLEFVDQVFGPESLEFDSLGRGPY Consensus KHE APY EVMGSWPRDN SRL G LEFV VFGPES EFD GRGPY Maize MS45 protein AGLADGRVVRWMGEEAGWETFAVMNPDWSEEVCANGVNSTTRKQHEKEEF Arabidopsis NP_974462 TGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKL Consensus GLADGRVVRWMGE GWETF V WSEE C GV STT KQ E Maize MS45 protein CGRPLGLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRFA Arabidopsis NP_974462 CGRPLGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFA Consensus CGRPLGLRFH ETG LY ADAYYGL VVG GG A A G PI FA Maize MS45 protein NDLDVHRNGSVFFTDTSMRYSRKDHLNILLEGEGTGRLLRYDPETSAVHV Arabidopsis NP_974462 NDLDIHRNGSIFFTDTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHI Consensus NDLD HRNGS FFTDTS RY R H ILLEGE TGRLLRYDP T H Maize MS45 protein VLKGLVFPNGVQISEDHQFLLFSETTNCRIMRYWLEGPRASEVEVFANLP Arabidopsis NP_974462 VLEGLAFPNGIQLSKDQSFLLFTETTNCRLVKYWLEGPKMGEVEVVADLP Consensus VL GL FPNG Q S D FLLF ETTNCR YWLEGP EVEV A LP Maize MS45 protein GFPDNVRSNGRGQFWVAIDCCRTPAQEVFAKRPWLRTLYFKFPLSLKVLT Arabidopsis NP_974462 GFPDNVRINEEGQFWVAIDCCRTPAQEVLTNNPWIRSIYFRLPIPMKLLA Consensus GFPDNVR N GQFWVAIDCCRTPAQEV PW R YF P K L Maize MS45 protein WKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGSKLWIGTV Arabidopsis NP_974462 KTMGMRMYTVISRFDEEGKVLEVLEDR-----------QGKVMKLWIGTV Consensus RM TV D EG V EVLEDR KLWIGTV Maize MS45 protein AHNHIATIPYPLED-- Arabidopsis NP_974462 AHNHIATLPYPLTMNQ Consensus AHNHIAT PYPL Maize MS45 promoter ACGTCAGGTTCGGCAGCTCTCGTG----TC-ATCTCACATGG---CATAC AT3G59530 promoter AGTTTTGGTTAGATGATTATTTTGAAGCTCTATCTCAAATAGAGTCATGA Consensus A T GGTT G T T TG TC ATCTCA AT G CAT Maize MS45 promoter TACATGCTTGTTCAACCGTTCGTCTTGTTCCATCGTCCAAGCCTTGCCTA AT3G59530 promoter GAATTGTATTTGGTATCAGA-GTAGTCTAACTTAGATCAACTTTTGACTA Consensus A TG T T A C GT T T C T G CAA TTG CTA 200 Maize MS45 promoter -TTCTGAACCAAGAGGATACCTACTCCCAAACAATCCATCTTACTCATGC AT3G59530 promoter GTTGTTTGTTTCCATTGAACCTACTTTCAACC---CAATTTTATTCACAA Consensus TT T A ACCTACT CAA C C AT TTA TCA Maize MS45 promoter AACTTCCATGCAAA--CACGCACATATGTTTCCTGAACCAATCCA—TTA AT3G59530 promoter GATCTGCATTTCTCTGCACCCACAATGTTTTACATTGCTTATATAATTTG Consensus A T CAT CAC CACA TTT C C AT A TT 251 300 Maize MS45 promoter AAGATCACAACAGCTAGCGTTCTCCCGCTAGCTTCCCTCTCTCCTCTGCC AT3G59530 promoter TACATTG-ATCAGGTGA—ATCTGATCTTACTTTCTGGTCCACCTCTAAG Consensus A AT A CAG T TCT TA TTC C CCTCT 301 324 Maize MS45 promoter GATCTTTTTCGTCCACCACCATG AT3G59530 promoter CA-CTTTT------A—ACCATG Consensus A CTTTT A ACCATG SFig. 1 Maize MS45 promoter GGTGCCTACGTCAGGTTCGGCAGCTCT---CGTGTCATCTCACATGGCAT LOC_Os03g15710 ATGGCCATGGTCAGGGCCCTCAGCCCTGGCCGGGTTCGGTTACATG-CAT Consensus GCC GTCAGG C CAGC CT CG GT T ACATG CAT Maize MS45 promoter ACT-ACATGCTTGTTCAACCGTTCGTCTTGTTCCATCGTCCAAGC----- LOC_Os03g15710 CGTGATATGCTTGTTGACCTGTGCATCTTGCACCGTCATCCAAGCAATGC Consensus T A ATGCTTGTT A C GT C TCTTG CC TC TCCAAGC Maize MS45 promoter -------------------------------------CTTGCCTATTCTG LOC_Os03g15710 AAAACATGCAAATCCCCACTTCGAAAGCACAAGATTCCTTGGCTATTCCG Consensus CTTG CTATTC G Maize MS45 promoter AACCAAGAGGATACCTACTCCCAAACAATCCATCTTACTCATGCAACTTC LOC_Os03g15710 AACCAACAGAACACCTACTCCCAAACAATCACGCTGACTCATGCAACCTC Consensus AACCAA AG A ACCTACTCCCAAACAATC CT ACTCATGCAAC TC Maize MS45 promoter CATGCAAACACGCACATATGTTTCCTGAACCAATCCATTAA--AGATCAC LOC_Os03g15710 CATGCAT---CGAAGATATATTTTCGCTGCAAAGGCATTAAGAATTTAAG Consensus CATGCA CG A ATAT TTT C C AA CATTAA A T A Maize MS45 promoter AACAGCTAGCGTTCTCCCGCTAGCTTCCCTCTCTCCTCTGCCGATCTTTT LOC_Os03g15710 TTAAGATCACCGTCTCCACCAA--TTCCGTCTTTCCTCTGCGTGCAAATT Consensus AG T C TCTCC C A TTCC TCT TCCTCTGC TT Maize MS45 promoter TCGTCCACC----------A---CCATG LOC_Os03g15710 CCGTCTTCCCTCGCTCCTGATCTCCATG Consensus CGTC CC A CCATG


Download ppt "Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK."

Similar presentations


Ads by Google