Presentation is loading. Please wait.

Presentation is loading. Please wait.

Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK.

Similar presentations


Presentation on theme: "Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK."— Presentation transcript:

1 Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_ MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK Q R RGRDGI QYPHLFFAALALALL DPF L PLA VDYR Maize MS45 protein PVKHELAPYGEVMGSWPRDNASRLRRGRLEFVGEVFGPESIEFDLQGRGP Rice NP_ PVRHELAPYREVMARWPRDNGSRLRHGRLEFVGEVFGPESIEFDRHGRGP Consensus PV HELAPY EVM WPRDN SRLR GRLEFVGEVFGPESIEFD GRGP Maize MS45 protein YAGLADGRVVRWMGEEAGWETFAVMNPDWSEEVCANGVNSTTRKQHEKEE Rice NP_ YAGLADGRVVRWMGEDAGWETFAVMSPDWSEKVCANGVESTTKKQHEMER Consensus YAGLADGRVVRWMGE AGWETFAVM PDWSE VCANGV STT KQHE E Maize MS45 protein FCGRPLGLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRF Rice NP_ RCGRPLGLRFHGETGELYVADAYYGLMSVGPNGGVATSLAREVGGSPVNF Consensus CGRPLGLRFHGETGELYVADAYYGLM VG GGVA S ARE G P F Maize MS45 protein ANDLDVHRNGSVFFTDTSMRYSRKDHLNILLEGEGTGRLLRYDPETSAVH Rice NP_ ANDLDIHRNGSVFFTDTSTRYNRKDHLNVLLEGEGTGRLLRYDPETKAAH Consensus ANDLD HRNGSVFFTDTS RY RKDHLN LLEGEGTGRLLRYDPET A H Maize MS45 protein VVLKGLVFPNGVQISEDHQFLLFSETTNCRIMRYWLEGPRASEVEVFANL Rice NP_ VVLSGLVFPNGVQISDDQQFLLFSETTNCRIMRYWLEGPRAGQVEVFADL Consensus VVL GLVFPNGVQIS D QFLLFSETTNCRIMRYWLEGPRA VEVFA L Maize MS45 protein PGFPDNVRSN---GRGQFWVAIDCCRTPAQEVFAKRPWLRTLYFKFPLSL Rice NP_ PGFPDNVRLSSGGGGGRFWVAIDCCRTAAQEVFAKRPWLRTLYFKLPLTM Consensus PGFPDNVR G G FWVAIDCCRT AQEVFAKRPWLRTLYFK PL Maize MS45 protein KVLTWKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGSKLW Rice NP_ RTLGKMVSMRMHTLVALLDGEGDVVEVLEDRGGEVMRLVSEVREVGRKLW Consensus L RMHT ALLDGEG VVEVLEDRG EVM LVSEVREVG KLW Maize MS45 protein IGTVAHNHIATIPYPLED Rice NP_ IGTVAHNHIATIPYPLEEQSSSSSSNVLGD Consensus IGTVAHNHIATIPYPLE Maize MS45 protein MEEKRKLQWRRGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYRPV Arabidopsis NP_ MEKKG--QHGTYESMMTHHPILCIIALSVLFIAIDPFHMSPIGGREFKPV Consensus ME K Q P L AL DPF SP PV Maize MS45 protein KHELAPYGEVMGSWPRDNASRLR-RGRLEFVGEVFGPESIEFDLQGRGPY Arabidopsis NP_ KHEVAPYKEVMGSWPRDNLSRLGNHGKLEFVDQVFGPESLEFDSLGRGPY Consensus KHE APY EVMGSWPRDN SRL G LEFV VFGPES EFD GRGPY Maize MS45 protein AGLADGRVVRWMGEEAGWETFAVMNPDWSEEVCANGVNSTTRKQHEKEEF Arabidopsis NP_ TGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKL Consensus GLADGRVVRWMGE GWETF V WSEE C GV STT KQ E Maize MS45 protein CGRPLGLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRFA Arabidopsis NP_ CGRPLGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFA Consensus CGRPLGLRFH ETG LY ADAYYGL VVG GG A A G PI FA Maize MS45 protein NDLDVHRNGSVFFTDTSMRYSRKDHLNILLEGEGTGRLLRYDPETSAVHV Arabidopsis NP_ NDLDIHRNGSIFFTDTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHI Consensus NDLD HRNGS FFTDTS RY R H ILLEGE TGRLLRYDP T H Maize MS45 protein VLKGLVFPNGVQISEDHQFLLFSETTNCRIMRYWLEGPRASEVEVFANLP Arabidopsis NP_ VLEGLAFPNGIQLSKDQSFLLFTETTNCRLVKYWLEGPKMGEVEVVADLP Consensus VL GL FPNG Q S D FLLF ETTNCR YWLEGP EVEV A LP Maize MS45 protein GFPDNVRSNGRGQFWVAIDCCRTPAQEVFAKRPWLRTLYFKFPLSLKVLT Arabidopsis NP_ GFPDNVRINEEGQFWVAIDCCRTPAQEVLTNNPWIRSIYFRLPIPMKLLA Consensus GFPDNVR N GQFWVAIDCCRTPAQEV PW R YF P K L Maize MS45 protein WKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGSKLWIGTV Arabidopsis NP_ KTMGMRMYTVISRFDEEGKVLEVLEDR QGKVMKLWIGTV Consensus RM TV D EG V EVLEDR KLWIGTV Maize MS45 protein AHNHIATIPYPLED-- Arabidopsis NP_ AHNHIATLPYPLTMNQ Consensus AHNHIAT PYPL Maize MS45 promoter ACGTCAGGTTCGGCAGCTCTCGTG----TC-ATCTCACATGG---CATAC AT3G59530 promoter AGTTTTGGTTAGATGATTATTTTGAAGCTCTATCTCAAATAGAGTCATGA Consensus A T GGTT G T T TG TC ATCTCA AT G CAT Maize MS45 promoter TACATGCTTGTTCAACCGTTCGTCTTGTTCCATCGTCCAAGCCTTGCCTA AT3G59530 promoter GAATTGTATTTGGTATCAGA-GTAGTCTAACTTAGATCAACTTTTGACTA Consensus A TG T T A C GT T T C T G CAA TTG CTA 200 Maize MS45 promoter -TTCTGAACCAAGAGGATACCTACTCCCAAACAATCCATCTTACTCATGC AT3G59530 promoter GTTGTTTGTTTCCATTGAACCTACTTTCAACC---CAATTTTATTCACAA Consensus TT T A ACCTACT CAA C C AT TTA TCA Maize MS45 promoter AACTTCCATGCAAA--CACGCACATATGTTTCCTGAACCAATCCA—TTA AT3G59530 promoter GATCTGCATTTCTCTGCACCCACAATGTTTTACATTGCTTATATAATTTG Consensus A T CAT CAC CACA TTT C C AT A TT Maize MS45 promoter AAGATCACAACAGCTAGCGTTCTCCCGCTAGCTTCCCTCTCTCCTCTGCC AT3G59530 promoter TACATTG-ATCAGGTGA—ATCTGATCTTACTTTCTGGTCCACCTCTAAG Consensus A AT A CAG T TCT TA TTC C CCTCT Maize MS45 promoter GATCTTTTTCGTCCACCACCATG AT3G59530 promoter CA-CTTTT------A—ACCATG Consensus A CTTTT A ACCATG SFig. 1 Maize MS45 promoter GGTGCCTACGTCAGGTTCGGCAGCTCT---CGTGTCATCTCACATGGCAT LOC_Os03g15710 ATGGCCATGGTCAGGGCCCTCAGCCCTGGCCGGGTTCGGTTACATG-CAT Consensus GCC GTCAGG C CAGC CT CG GT T ACATG CAT Maize MS45 promoter ACT-ACATGCTTGTTCAACCGTTCGTCTTGTTCCATCGTCCAAGC----- LOC_Os03g15710 CGTGATATGCTTGTTGACCTGTGCATCTTGCACCGTCATCCAAGCAATGC Consensus T A ATGCTTGTT A C GT C TCTTG CC TC TCCAAGC Maize MS45 promoter CTTGCCTATTCTG LOC_Os03g15710 AAAACATGCAAATCCCCACTTCGAAAGCACAAGATTCCTTGGCTATTCCG Consensus CTTG CTATTC G Maize MS45 promoter AACCAAGAGGATACCTACTCCCAAACAATCCATCTTACTCATGCAACTTC LOC_Os03g15710 AACCAACAGAACACCTACTCCCAAACAATCACGCTGACTCATGCAACCTC Consensus AACCAA AG A ACCTACTCCCAAACAATC CT ACTCATGCAAC TC Maize MS45 promoter CATGCAAACACGCACATATGTTTCCTGAACCAATCCATTAA--AGATCAC LOC_Os03g15710 CATGCAT---CGAAGATATATTTTCGCTGCAAAGGCATTAAGAATTTAAG Consensus CATGCA CG A ATAT TTT C C AA CATTAA A T A Maize MS45 promoter AACAGCTAGCGTTCTCCCGCTAGCTTCCCTCTCTCCTCTGCCGATCTTTT LOC_Os03g15710 TTAAGATCACCGTCTCCACCAA--TTCCGTCTTTCCTCTGCGTGCAAATT Consensus AG T C TCTCC C A TTCC TCT TCCTCTGC TT Maize MS45 promoter TCGTCCACC A---CCATG LOC_Os03g15710 CCGTCTTCCCTCGCTCCTGATCTCCATG Consensus CGTC CC A CCATG


Download ppt "Maize MS45 protein MEEKRKLQWR--RGRDGIVQYPHLFFAALALALLVADPFGLSPLAEVDYR Rice NP_912416 MEEKKQQQQRPQRGRDGILQYPHLFFAALALALLLTDPFHLGPLAGVDYR Consensus MEEK."

Similar presentations


Ads by Google