Presentation is loading. Please wait.

Presentation is loading. Please wait.

Supplementary Figure 1. A phylogram displaying the relationship of the homologs to other MYB proteins. The data indicates that OsMYB80 and TaMYB80 are.

Similar presentations

Presentation on theme: "Supplementary Figure 1. A phylogram displaying the relationship of the homologs to other MYB proteins. The data indicates that OsMYB80 and TaMYB80 are."— Presentation transcript:

1 Supplementary Figure 1. A phylogram displaying the relationship of the homologs to other MYB proteins. The data indicates that OsMYB80 and TaMYB80 are closely related to GhMYB80, AtMYB80 and BnMYB80 than other MYB proteins. The tree distances in the phylogram are included in brackets. The phylogram was generated using VectorNTI software (Invitrogen) and peptide sequences obtained from TAIR and TIGR databases. AtMYB80 (0.0321) BnMYB80 (0.0308) GhMYB80 (0.1860) OsMYB80 (0.0838) TaMYB80 (0.0791) AtMYB35 (0.3191) AtMYB4 (0.1944) AtMYB32 (0.1934) AtMYB41 (0.2087) AtMYB74 (0.1371) AtMYB102 (0.1546) Os03g18480 (0.3100) Os02g42870 (0.2969) Os08g37970 (0.2996) Os04g38740 (0.3109) Os12g07640 (0.2380)

2 Supplementary Figure 2. Promoter sequence alignment of Arabidopsis, Canola, Rice and Wheat MYB80. The promoter sequences are immediately upstream of the ATG translational start site. The alignment was performed using MUSCLE ( Blue represents high and purple represents moderate similarity, respectively. A highly conserved region is underlined in black.

3 Supplementary Figure 3. The AtMYB80 promoter contains a conserved region immediately upstream of the transcript start site. PLACE analysis identified four motifs which are conserved amongst the four species within this region. The motifs are underlined and coloured as follows, TGAC, W-BOX; GTGA and TCAC, GTGANTG10; ACCTACC, MYB4 ( A / T ACC MYB-core). The purple underlined sequence (CGTTGAATTCTTTA) is present in all four promoters with a highly conserved DOFCOREZM binding site ( A / T AAAG) (orange). Motif analysis was performed using cis-PLACE ( GGAGTTGACCA.....TGGGTGACCTACCGG....ATCACA.....GTAGCGTTGAATTCTTTA -300bp


5 Supplementary Figure 5. The conserved amino acid sequence downstream of the MYB domain forms two α-helical structures (underlined). The sequence analysis was performed using NPS@: Network Protein Sequence Analysis ( bin/ NPSA/npsa_server.html). IDPVTHKPFSHLMAEITTTLNPPQVSHLAEAALGCFKDEMLHLLTKKRV


Download ppt "Supplementary Figure 1. A phylogram displaying the relationship of the homologs to other MYB proteins. The data indicates that OsMYB80 and TaMYB80 are."

Similar presentations

Ads by Google