Presentation is loading. Please wait.

Presentation is loading. Please wait.

Olga Kalinina, Olga Znoiko Saint-Petersburg Pasteur Institute Moscow State University of Dentistry and Medicine CLINICAL AND EPIDEMIOLOGICAL FEATURES OF.

Similar presentations


Presentation on theme: "Olga Kalinina, Olga Znoiko Saint-Petersburg Pasteur Institute Moscow State University of Dentistry and Medicine CLINICAL AND EPIDEMIOLOGICAL FEATURES OF."— Presentation transcript:

1 Olga Kalinina, Olga Znoiko Saint-Petersburg Pasteur Institute Moscow State University of Dentistry and Medicine CLINICAL AND EPIDEMIOLOGICAL FEATURES OF THE NATURAL HEPATITIS C VIRUS RECOMBINANT RF1_2k/1b RF1_2k/1b

2 Genome organization of Hepatitis C Virion Lindenbach and Rice, 2005 IRES

3 Genetic diversity of Hepatitis C Virus based on a high mutation rate a high mutation rate Quasispecies Genotypes/ Clades Genotypes/ Clades from 1 to 630-35% Subtypes Subtypes varying numbers from a to …20-25% Isolates10%

4 Geographic Distribution of HCV Clades/Genotypes India Europa North America Latin America Egypt 1b 1b 1a, 2a, 2b, 2c, 3a 1a, 1b 1a, 1b 2a, 2b, 3a 4 5a South Africa 1b, 3a 1b, 6, 3a, 2a Australia China, Cambodia, Vietnam Japan Russia 1b, 3a 1b, 3a 1a, 2a, 2b, 2c, 2k 1b Cameroon 4, 1

5 Genetic diversity of Hepatitis C Virion based on recombination PJ6CF USA PH77CV Chimera HC-J6 Japan 778 St.Petersburg 686 St.Petersburg 300 St.Petersbur g BEBE1 Japan HCJK081 Jakarta HCJK139 Thailand 611 R St.Petersburg 203 R St.Petersburg 747 R St.Petersburg 796 R St.Petersburg 674 R St.Petersburg 687 R St.Petersburg VAT-96 Moldova 464 St.Petersburg HCJK025 Jakarta HCJK109 Jakarta Md2b-1 VN004 Vietnam VN405 Vietnam VN235 Vietnam HCJK046 Jakarta 2 6 5a b e k f c a 100 9191 75 91 CORE HC16362 Korea HCV-JS Japan MD8-2 Japan HCV-L2 Korea HC-C2 China HPVHCVN Japan HCV-HB China MD4-1 Japan 309 St.Petersburg 576 St.Petersburg 204 St.Petersburg HCJTa Japan HCJTb Japan 643 St.Petersburg 788 St.Petersburg 779 St.Petersburg 704 St.Petersburg 615 St.Petersburg HD-1 Germany 747 R St.Petersburg 674 R St.Petersburg 796 R St.Petersburg 687 R St.Petersburg 611 R St.Petersburg 203 R St.Petersburg 761 St.Petersburg 185 St.Petersburg 783 St.Petersburg 735 St.Petersburg 589 St.Petersburg 789 St.Petersburg 728 St.Petersburg 700 St.Petersburg 732 St.Petersburg MD1-1 Japan MD1-2 Japan MD5-1 Japan HPCPP Japan HCV-H USA PH77CV Chimera HC-J1 USA 785 St.Petersburg EUH1480 South Africa 1 5a a b 100 95 NS5B Flaviviridae  Flavivirus Dengue virus (Holmes et al, 1999; Tolou et al, 2001)  Pestivirus Bovine viral diarrehea virus virus (Ridpath et al, 2000)  Hepacivirus Hepatitis C virus (Kalinina et al. 2002) SimPlot – Query: 687 R 2k/1b Saint-Petersburg K1-S2 1b VAT-96 2k

6 CJTA... CJTB... 198 04 105... 1170 105... 1152 105... 1766 105... 1192 105... HCV N... 1187 105... 450 105... 735 105... 1182 105... 380 105... 2055 Estonia... 644 105... 2191 105... MD4 1... HPCGENOM... 2246 105... HPCRNA... HPVHCVN... 1774 105... HCD85516... HC16362... MD8 2... HCU01214... 1189 105... 643 105... 640 Estonia... 2187 105... MD3 1... 2035 Estonia... 1155 Estonia... CJ483... HC J4... 455 105... 514 105... 187 04 105... 728 105... 480 105... 448 105... 1188 105... 2188 105... 607 Estonia... 2079 Estonia... 615 Estonia... 197 04 105... 201 04 105... 641 105... 1171 105... 1163 Estonia... 622 Estonia... GQ418317 cirrhosis Indonesia 2007 1... 2077 Estonia... 1160 105... K1 R3... 2248 105... 383 105... 2178 105... CON1... 1145 105... 589 105... 181 04 105... 197 03 105... AF071987 1bSweden... MD2 1... MD1 1... MD5 1... HPCPP... 377 105... 2180 105... GQ418304 indonesia... 177 04 105... 2051 Estonia... JF424774 USA pat 26 2008 1... 1178 105... D89815... DQ345619 Madagascar 2004... 185 105... 2185 105... HM106914 Irlend 2011 non recom 1... EU710293 australia... 568 105... Рекомбинант RF_2k/1b 1777 105... J33... 1161 105... K1 S3... K1 R2... K1 S2... HD 1... 678 105... 1196 105... DQ508480 Tunisia hemodialysis... 704 105... 1194 105... 892 105... 779 105... 2019 Estonia... K1 S1... 1146 105... 885 105... 2031 Estonia... 761 105... HCV AD78... 1776 105... HCVPOLYP... 1153 105... 576 105... 176 04 105... 2052 Estonia... 2022 Estonia... 1149 Estonia... 1159 105... 645 105... 1162 105... 730 105... 742 105... 732 105... 700 105... EF543254 Tailand 2007 1... 183 04 105... 200 04 105... HPCP1... субтип 1а

7 Recently revelead inter-genotype HCV Recombinants 2i/6p recombination point within the NS2/NS3 region from blood donor, Ho Chi Minh City Vietnam 2005 2/5 recombination point within the NS2/NS3 region, France 2007 2b/1b recombination point within the NS2/NS3 region Metro Manila Philippines 2006 RF1_2k/1b Russia, Siberia, Estonia, Uzbekistan, Sweden, Ireland, Holland, France, Azerbaijan, Cyprus 2b/1a recombination point within the NS2/NS3 region, USA 2011 2b/6w recombination point beginning the NS3 region Taiwan 2010

8 Recently revelead intra-genotype HCV Recombinants 1b/1a recombination point within the NS5B Peru 2004 1a/1c two recombination points within the E1-E2 regions Japan 2006 1a/1c five recombination points within the core- NS3 regions India 2008 1b/1a recombination point within the core Uruguay 2009

9 CONCLUSIONS I  Currently, more than 40 recombinant RF1_2k/1b strains circulating in the human population are known; most of them from the former Soviet Union Countries where recombinant has likely emerged  At present, six natural inter-genotyping and four intra-genotyping recombinant HCV forms were identified in the world Recombination plays a significant role in the HCV evolution by creating genetic variants with new properties that has to be studied  Recombination plays a significant role in the HCV evolution by creating genetic variants with new properties that has to be studied

10 Genome organization of HCV Recombinant RF1_2k/1b Predicted amino acid sequences for HCV Recombinant number of the amino acid residues genome region genotype2 (HC-J6) RF1-2k/1b (N687 StP) subtype1b (HC-J4) subtype 1b (N589 StP) ORF 3033 3014 3010 Core 191 E1 192 E2 367 363 p7 63 NS2 217 NS3 631 NS4a 54 NS4b 261 NS5a 466 447 NS5b 591 ISDR region within NS5A 2216222622362246 APSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENK HC-J4 1b.......................................... 687 R..........R............................... k1-s2 1b..........R.............................A. 589 1b....R......GKAY.V.MVD...F----...DV..I...S. HCJ6 2a....R....A.AKNYAVEMVD..FF----..SDV..I...T. Vat96 2k........Q..RPH...E.VN..........S........T. CB 3a........Q..RPH...E.VD..........S........T. NZL1 3a 658668 678 RDRSELSPLLLSTTEWQTLPC HC-J4 1b.................I... k1-s2 1b.................I... 589 1b....Q.....H.....AI... 687 R.... Q.....H.....AI... 674 R....Q.....H.....AI... 747 R....Q.....H.....AI... 796 R....Q.....H.....AI... Vat96 2k....Q.....H.....AI... HCJ6 2a.....QH...H....LAI... CB 3a.....QH...H....LAI... NZL1 3a PePHD region within E2

11 Serine at position 2300 is associated with resistance to interferon + ribaverin therapy (Bouzgarrou et al., 2009) 2260227022802290 ILDSFDPLRAEEDEREVSVAAEILRKSKKFPPALPIWARPDYNPPL HC-J4 1b V......I.P.........P.......R...R.M............ 687 RF........Q..........P.......R...R.I............ M21 RF.....E............LP.......R.....M............ k1-s2 1b.....E..........I..P.......R.................. 589 1b V...L..MVE.RSDL.P.IPS.YMLPK.R......A.......... HC-J6 2a....L..SVE......P..PS.Y.LPK....Q...V.........V VAT-96 2k.....E.....T.DA.L.....CFK.PP.Y................ CB 3a V....E.....T.DV.P.....CFK.PP.Y................ NZL1 3a 2300 2310232023302340 LESWKSPDYVPPAVHGCPLPPTTGPPIPPPRKKRTVVLTESTVSSA HC-J4 1b.A...D....H.V.........KA.......R.............. 687 RF.....D......V.........KA..V....R.............. M21 RF I....D......V.........KA.......R.............. k1-s2 1b..P..D......V.........KA...................... 589 1b V....R...Q.AT.A..A...PKKT.T....RR...G.S..SIAD. HC-J6 2a V.T..R...D..T.S..A...RVTA.T....RR.AL..SQ.N.GE. VAT-96 2k.DR..A......T....A...RGA..V....R...IQ.DG.N..A. CB 3a.DR..A......T....A...RGA..V....R...IQ.DG.N..A. NZL1 3a 2350236023702380 LAELATKTFGSS-----GSSAVDSGTATAPPDQTSDDGDKESDVES HC-J4 1b............-----..........S..QN...N...TG..... 687 RF............-----.............YN...N...AG..... M21 RF............-----E...A...........P.N...AG..... k1-s2 1b............-----E...............A............ 589 1b.QQ..I.S..QPPPSGDSGLSTGADA.DSG-SR.PP.ELAL.ETG. HC-J6 2a.QA..I.S..QLPPSCDSGRSTGMD.TD.T-..PALKESTD.EAG. VAT-96 2k.RA..E.S.P.LKPQEENN.SSGVD.QSSTTSKVPPSPGG...S.. CB 3a..A..E.S.P..KPQEEN..SSGVD.QSSTTSKVPPSPGG...S.. NZL1 3a 22102220223022402250 LSAPSLKATCTTHHDSPDADLIEANLLWRQEMGGNITRVESENKVV HC-J4 1b.............................................. 687 RF.............................................. M21 RF............R................................. k1-s2 1b............R...................C.........A... 589 1b......R......GKAY.V.MVD...F----...DV..I...S... HC-J6 2a......R....A.AKNYAVEMVD..FF----..SDV..I...T..L VAT-96 2k..........Q..RPH...E.VN..........S........T... CB 3a..........Q..RPH...E.VD..........S........T... NZL1 3a Interferon sensitivity-determining region ISDR/PKR binding domain V3 variable domain

12 Outcome of Hepatitis C Infection  HCV sensitivity to interferon therapy mainly depends on genotype and is the poorest for HCV 1b.  Genotype accounting for recombination is important for selection the therapy approach(es) and prognosis the response

13 Outcome of Recombinant RF1_2k/1b Hepatitis C Infection Patients  N 1763 men, 51 years old, chronic hepatitis C, revealed as a contact person with patient N 1764 with patient N 1764  N 1764 feminine, 34 years old, acute hepatitis C, icteric form, 20 days after onset biochemical level became normal after onset biochemical level became normal  M21 (sampled in France) men, 30 years old, IVDU, chronic hepatitis C, known as infected by HCV genotype 3a ( Morel et al., 2010)

14 Outcome of Recombinant RF1_2k/1b Hepatitis C Infection Patients N 1764, feminine, 34 years old, acute hepatitis C, icteric form, 20 days after onset biochemical level became normal 20 days after onset biochemical level became normal  During the following 12 months she was positive for RNA HCV, had increasing level of liver enzyme and progressed to chronic hepatitis  After one year from onset of disease patient received mono-therapy by α2a-interferon: 3 000 000 Units three times per week  by week 12, it was observed early virological response. Following 36 weeks patient received the same therapy  by week 48, it was sustained virological and biochemical responses (also after 5 years later)

15 Outcome of Recombinant RF1_2k/1b Hepatitis C Infection Patients N 1763, men, 51 years old, chronic hepatitis C  patient received mono-therapy by α2a-interferon: 3 000 000 Units three times per week  by week 12, it was observed only biochemical responses but not virological  after that patient received α2a-interferon + RIBA  by week 16, it was still not virological response  no progression of fibrosis stage for 6 years  elastography (Fibroscan Echosens) in 2007 Fibrosisscore - F1,  elastography (Fibroscan Echosens) in 2007 Fibrosis score - F1, in 2010 Elastography - F2 in 2010 Elastography - F2  at 2010 patient received Peg IFN + RIBA, by week 24, it was not virological and biochemical responses

16 Outcome of Recombinant RF1_2k/1b Hepatitis C Infection M21 (sampled in France) men, 30 years old, chronic hepatitis C, known as infected by HCV genotype 3a (Morel et al., 2010)  patient received combination therapy by pegylated interferon and ribavirin  by week 24, it was observed virological response. One month later HCV RNA didn’t also detected in the serum HCV RNA didn’t also detected in the serum  Three months post-treatment, it was noted virological relapse with increasing level of ALT with increasing level of ALT  HCV strain belonged to genotype 3a was no longer found. In the same time in the serum samples HCV strain was subtypes In the same time in the serum samples HCV strain was subtypes as recombinant RF1_2k/1b as recombinant RF1_2k/1b

17 CONCLUSIONS II  At present HCV recombinant RF1_2k/1b has to be considered as “difficult-to-treat” genotype  Further studies are emergency needed to define the long-term outcome and strategy for antiviral therapy in the case of RF1_2k/1b

18 Acknowledgements IN THE EPIDEMIOLOGY STUDY PARTICIPATED Lars O Magnius, Helene Norder Swedish Institute for Infectious Disease Control Tatjana Tallo Sergey MukomolovSt. Petersburg Pasteur Institute Olga ZnoikoMoscow State University of Medicine and Dentistry Maria Isaguliants Swedish Institute for Infectious Disease Control Ivanovsky Institute, Moscow Valentina Tchakharian State Centre for Epidemiological Surveillance Konstantin Zhdanov Medical Military Academy, St. Petersburg Denis GusevMedical Military Academy, St. Petersburg Timophei Vetrov St. Petersburg Pavlov Medical University Pavel Kislii St. Petersburg Metchnikov Medical Academy

19 Acknowledgements THANK YOU for YOUR ATTENTION


Download ppt "Olga Kalinina, Olga Znoiko Saint-Petersburg Pasteur Institute Moscow State University of Dentistry and Medicine CLINICAL AND EPIDEMIOLOGICAL FEATURES OF."

Similar presentations


Ads by Google