Presentation is loading. Please wait.

Presentation is loading. Please wait.

Sequence Alignment and Phylogeny Dr Peter Smooker, B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S.

Similar presentations


Presentation on theme: "Sequence Alignment and Phylogeny Dr Peter Smooker, B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S."— Presentation transcript:

1 Sequence Alignment and Phylogeny Dr Peter Smooker, B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S

2 Uses of alignments 1.To determine the relationship (ie: distance) between two sequences (pair-wise alignment) 2.To search databanks for the presence of homologues 3.To look for sequence conservation in families of proteins 4.To use molecular approaches to phylogeny

3 Comments/Caveats When sequences are aligned, we assume they share a common ancestor Protein fold is more conserved than protein sequence DNA sequences are less informative than protein sequences Two sequences can always be aligned- we need to determine what is a meaningful result

4 Homology Proteins or genes are defined as homologous if they can be said to have shared an ancestor Genes or proteins are either homologs or they are not- there is no such thing as percent homology. There is percent identity or similarity of the sequences

5 “Ologies” Homology - descent from a common ancestor Orthology - descent from a speciation event Paralogy - descent from a duplication event Xenology - descent from a horizontal transfer event

6 When Is Homology Real? As a general rule, in a pairwise alignment: >25% identical aa’s, proteins will have similar folding pattern- most likely homologous 18-25% identical- twilight zone- tantalizing <18% identical- cannot determine from alignment

7 Measuring Sequence Similarity Two measures of the distance between two strings: 1.Hamming distance: strings equal length, number of positions with mismatches 2.Levenshtein distance: not equal length, number of edit operations to change one string to the other

8 agtcHamming distance = 2 cgta ag-tccLevenshtein distance = 3 cgctca

9 Protein Alignments- Substitution Matrices When sequences diverge over time, they accumulate mutations- some are deleterious, some are neutral, some are advantageous Some changes are more likely than others This can be examined and the relative probability of a change occurring calculated Substitution matrices have been developed

10 Matrices. PAM = Percent Accepted Mutation Matrices are derived from families of proteins with a set level of identity. PAM matrices proposed by Margaret Dayhoff. Based on sequences with > 85% identity. The PAM 1 matrix was computed. Extrapolated for larger evolutionary distances

11 PAM Matrices PAM % identity The PAM250 matrix is corresponds to proteins of average 20% identity (lowest we can reasonably be confident about). It was derived by the extrapolation of observed substitution frequencies. PAM250 refers to 250 substitutions per 100 amino acids.

12 Definition of PAM from BLAST literature schul-1.htmlhttp://www.ncbi.nlm.nih.gov/BLAST/tutorial/Alt schul-1.html One "PAM" corresponds to an average change in 1% of all amino acid positions. After 100 PAMs of evolution, not every residue will have changed: some will have mutated several times, perhaps returning to their original state, and others not at all. Thus it is possible to recognize as homologous proteins separated by much more than 100 PAMs. Note that there is no general correspondence between PAM distance and evolutionary time, as different protein families evolve at different rates.

13 BLOSUM Matrices Developed by S and JG Henikoff Made use of a much larger amount of data Based on the BLOCKS database of aligned protein domains Used a weighted average of closely related sequences with identities higher than a threshold. For example, the common BLOSUM62 matrix is based on proteins with greater than 62% identity

14 BLOCKS The substitutions in each aligned column are identified and a score for each substitution calculated and inserted into the matrix.

15 Which Matrix to use? In BLASTP, the following matrices are offered: PAM 30 PAM 70 BLOSUM 80 BLOSUM 62 (default) BLOSUM 42 In PAM, greater numbers = more evolutionary distance. Reverse for BLOSUM

16 Which Matrix to use? Generally, BLOSUM perform better than PAM for local alignment searches Use the matrix appropriate for the task- if you expect a close match, use a low PAM or high BLOSUM number Generally, if you use the default (generally BLOSUM 62) and find nothing, go to a matrix derived from a more evolutionarily distant dataset

17 Scoring Score of mutation i > j log observed i >j expected i > j Expected i > j is simply calculated by the frequencies of the amino acids Result is multiplied by 10. Scores are added.

18 PAM250 A R N D C Q E G H I L K M F P S T W Y V A 2 R -2 6 N D C Q E G H I L K M F P S T W Y V

19 Scores below 0 indicate amino acids that are rarely substituted, and different aa’s that give a high +ve score are usually functionally equivalent Scores below 0 indicates that those substitutions are rarely observed

20 Hydrophilic

21 These aa’s are hydrophobic (except glycine, often put in a class by itself).

22 Interpreting scores- BLAST output

23

24 Significance Two values are given- the Bit score and the E- value. The E-value is a statistical calculation of the probability that the match is real, ie: that in a query database of that size, the sequence would give that score by chance The bit score is related to both the raw score (calculated from the BLOSUM or PAM lookup matrix) but is normalised

25 Bit Score Bit scores are normalised with respect to the scoring system. Hence they can be compared across different searches (using different matrices) In particular: To convert a raw score S into a normalized score S' expressed in bits, one uses the formula S' = (lambda*S - ln K)/(ln 2), where lambda and K are parameters dependent upon the scoring system (substitution matrix and gap costs) employed

26 Multiple Sequence Alignment To quote Lesk “One amino acid sequence plays coy; a pair of homologous sequences whisper; many aligned sequences shout out loud”

27 Multiple Sequence Alignment Multiple sequence alignments can offer a considerable amount of information over a pairwise alignment. –Regions of similarity (especially distant similarity) can be detected –Regions of functional significance can often be detected –Evolutionary relationships can be examined, and trees drawn.

28 MSA’s are computationally expensive If we use dynamic programming, rather than a 2D array as for pairwise comparison, have an n-dimensional array. Computational time grows as M n, where n is the number of sequences. Difficult for n=4, impossible for higher values. Use a heuristic approach. Most common is the CLUSTAL algorithm

29 Progressive Alignment Iterative pairwise alignment Two most similar sequences aligned first, then next most similar to that pair, etc. A very popular progressive alignment algorithm is CLUSTAL W

30 CLUSTAL W- Steps A matrix of pairwise distances between all sequences is constructed. This determines the similarity between all sequences to be aligned. A guide tree (dendogram), or inferred phylogeny, is built The alignment is constructed based on the guide tree. Generally results in a near-optimal alignment

31 CLUSTAL W A major problem in MSA is the selection of an appropriate matrix for alignments consisting of divergent and closely related sequences CLUSTAL W (weighted) assigns weights to a sequence dependent on how divergent it is from the two most closely related sequences Adapts gap penalties and scoring matrix to suit

32 An example (from our research) Some definitions: Phylogeny: Evolutionary history (“tree of life”) Molecular phylogeny: Determined using sequence data Bootstrapping: A statistical process to evaluate phylogenetic trees. The data is resampled 1000 times (generally) and the support for each branch determined Homology modelling. Predicting the structure of a protein based on the experimentally derived structure of a homologue

33 Fasciola- Liver Fluke NEJAdult

34 Liver fluke (Fasciola spp.) Trematode (flatworm) parasite Infects ruminants, humans Has a complex life-cycle Secretes proteins (excretory/secretory material) Major secreted protein is cathepsin L in adults

35 Cysteine proteases Digest proteins: cleave between adjacent amino acids. Not random cleavage, different proteases show a preference for different targets.

36 There are a number of Fasciola cathepsin L sequences known. At least 30 full sequences now known Only one contains an indel Protein sequences 46-99% identical

37 What are the differences between the two classes of CatL that account for the substrate specificity? Presumed to be due to changes affecting the S 2 subsite of the enzyme.

38 Homology Modelling FhCatL modelled on the known crystal structure of human CatL. Models of CatL2 and CatL5 (functional equivalent of CatL1) compared, especially around the S 2 subsite of the enzyme.

39 Homology Modelling Three substitutions is residues lining the S 2 subsite were observed (L5-> L2) L69Y: Makes substantial contacts with the P 2 Phe N161T: Side chain points away from pocket G163A: Bottom of pocket, no substantial contact with P 2 Phe

40 GRASP electrostatic surface potential The architecture around the S2 pocket is substantially influenced by a Y or L at position 69. Made mutant, expressed in yeast, performed kinetic analysis. L2 L5

41 Conclusions The L69Y change does affect the substrate specificity 69Y allows increased catalysis of substrates with a P 2 proline There are other, more subtle changes between L5 and L2

42 What about the other enzymes- CLUSTAL W

43 What amino acid is at #69?

44 FgCatL1-a 61 GNMGCSGG L MENAYEYLKQFGLETESSYPYTAVEGQCRYNRQLGVAKVTDYYTVHSGSEV 120 FgCatL1-b GNYGCMGG L MENAYEYLKQFGLETESSYPYTAVEGQCRYNRQLGVAKVTDYYTVHSGSEV FgCatL1-c GNFGCNGG L MENACEYLKRFGLETESSYPYRAVEGPCRYNKQLGVAKVTGYYMVHSGDEV FgCatL1-d GNHGCGGG Y MENAYEYLKHSGLETDSYYPYQAVEGPCQYDGRLAYAKVTDYYTVHSGDEV FgCatL1-e GNYGCMGG L MENAYEYLKQFGLETESSYPYTAVEDQCRYNRQLGVAKVTDYYTVHSGSEV FgCatL1-f GNNGCRGG L MEIAYEYLRRFGLEIESTYPYRAVEGPCRYDRRLGVAKVTGYYIVHSGDEV FgCatL2 GNMGCSGG L MENAYEYLKQFGLETESSYPYTAVEGQCRYNRQLGVAKVTDYYTVHSGSEV FgCatL3 GNINCMGG L MENAYEYLKQFGLETESSYPYTAVEGQCRYNRQLGVAKVTDYYTVHSGSEV FhCatL1 GNNGCGGG L MENAYQYLKQFGLETESSYPYTAVGGQCRYNKQLGVAKVTGYYTVQSGSEV FhCatL2 GNYGCGGG Y MENAYEYLKHNGLETESYYPYQAVEGPCQYDGRLAYAKVTGYYTVHSGDEI FhCatL3 GNNGCSGG L MENAYQYLKQFGLETESSYPYTAVEGQCRYNKQLGVAKVTGYYTVHSGSEV FhCatL4 GNYGCNGG L MENAYEYLKRFGLETESSYPYRAVEGQCRYNEQLGVAKVTGYYTVHSGDEV FhCatL5 GNYGCNGG L MENAYEYLKRFGLETESSYPYRAVEGQCRYNEQLGVAKVTGYYTVHSGDEV FhCatL6 GNYGCMGG L MENAYEYLKQFGLETESSYPYTAVEGQCRYNRQLGVAKVTDYYTVHSGSEV FhCatL7 GNYGCGGG Y MENAYEYLKHNGLETESYYPYQAVEGPCQYDGRLAYAKVTGYYTVHSGDEI FhCatL8 GNHGCGGG W MENAYKYLKNSGLETASYYPYQAVEYQCQYRKELGVAKVTGAYTVHSGDEM FhCatL9 GNNGCSGG L MENAYEYLKRFGLETESSYPYRAVEGQCRYNEQLGVAKVTGYYTVHSGSEV FhCatL10 GNHGCGGG W MENAYKYLKNSGLETASDYPYQGWEYQCQYRKELGVAKVTGAYTVHSGDEM **.* ** ** * :**:. *** * ***. *:*.*. ****. * *:**.*:

45 Fasciola CatL’s form a monophyletic clade Fasciola sequences aligned to the family of papain-like cysteine proteases 100% bootstrap support for clade All Fasciola sequences arose after divergence from Schistosoma Probably all parasitic catLs have diverged after speciation (Sajid and McKerrow)

46

47 Relationship of Fasciola enzymes Tree constructed using 18 full-length sequences Resolved into 4 distinct clades

48 L69Phe-Arg Y69Pro-Arg L69Phe-Arg AA69 Predicted Substrate W69 ??-Arg

49

50 Evolutionary Timeframe First observed divergence (clade A) 135 MYA F. hepatica and F. gigantica predicted to diverge approx. 19 –25 MYA Confirmed by constructing a neighbour- joining tree using Glutathione-S transferase sequences: 19 +/- 5.2 MYA

51 Practice runs- 1. Blast Go to the BLAST server at NCBI Note the different “flavours” of BLAST that can be performed. Go to Protein-Protein BLAST. Look at the format and the searching parameters. Paste in sequence 1 and run the BLAST

52 Sequence 1 What is it? (note that a conserved domain is detected) From what organism (should be 100% match)? What is the organism that has the closest relative? What is meant by “positives”?

53 For interest, use sequence 2 to run a BLAST. This is the mRNA sequence from which the protein sequence is translated. (note- choose your BLAST flavour carefully!) Is the same result obtained?

54 Practice runs- 2. CLUSTAL W Go to Upload (or paste) Seq3.txt, run the tool Does the dendogram resemble that previously demonstrated?


Download ppt "Sequence Alignment and Phylogeny Dr Peter Smooker, B I O I N F O R M A T I C S | | | | | | | B I O L O G Y - M A T H - S."

Similar presentations


Ads by Google