Presentation is loading. Please wait.

Presentation is loading. Please wait.

Jan Pačes Ústav molekulární genetiky Jiří Vondrášek Ústav organické chemie a biochemie

Similar presentations

Presentation on theme: "Jan Pačes Ústav molekulární genetiky Jiří Vondrášek Ústav organické chemie a biochemie"— Presentation transcript:

1 Jan Pačes Ústav molekulární genetiky Jiří Vondrášek Ústav organické chemie a biochemie Bioinformatika pro PřfUK 2001

2 Databáze: obsah principy SQL formáty biologických sekvencí IUB kódy DNA databáze proteinové a genomové databáze strukturní databáze

3 organizace databází Relační databáze c_ididentifikátor, číslo titletext journalkrátký text yeardatum …… a_ididentifikátor c_ididentifikátor namekrátký text k_ididentifikátor c_ididentifikátor keywordkrátký text

4 SQL: Structured Query Language c_ididentifikátor, číslo titletext journalkrátký text yeardatum …… CREATE TABLE article ( c_idINTEGER, titleTEXT, journalVARCHAR(30), yearDATE );

5 SQL: Structured Query Language CREATE TABLE author ( a_idINTEGER, c_idINTEGER, nameVARCHAR(30) ); a_ididentifikátor c_ididentifikátor namekrátký text

6 SQL: Structured Query Language INSERT INTO article SET c_id='1', title='Something absolutely fantastic', journal='Bioinformatics', year='2002'; INSERT INTO author SET a_id='1', c_id='1', name='Paces, Jan'; INSERT INTO author SET a_id='2', c_id='1', name='Vondrasek, Jiri';

7 SQL: Structured Query Language SELECT article.title,article.journal, FROM article,journal WHERE article.c_id = author.c_id AND article.year > '2000' AND LIKE 'Paces%';

8 kódnukleotidykomplement AAT CCG GGC TTA (UU)A MACK RAGY WATS SCGW YCTR KGTM VACGB HACTD DAGTH BCGTV NACGTN -mezera- kódtřípísmenný kódaminokyselina AAlaalanin CCyscystein DAspasparagová kyselina GGluglutamová kyselina HHishistidin IIleisoleucin KLyslysin LLeuleucin MMetmethionin NAsnasparagin PProprolin QGlnglutamin RArgarginin SSerserin TThrthreonin VValvalin WTrptryptofan YTyrtyrosin BAsxasparagová kys. nebo asparagin ZGlxglutamová kys. nebo glutamin XXxxjakákoliv aminokyselina *---stop nukleotidyaminokyseliny IUB kódy

9 binárnís chromatogramy pro programy minimální anotované textové SCF ALF ABI interní formáty databází text fasta EMBL GenBank ASN XML formáty sekvencí

10 SCF (standart chromatogram file) formáty sekvencí - SCF

11 EMBL (formát databáze EMBL) ID AF031150 standard; RNA; ROD; 1379 BP. XX AC AF031150; XX SV AF031150.1 XX DT 27-FEB-1998 (Rel. 54, Created) DT 27-FEB-1998 (Rel. 54, Last updated, Version 1) XX DE Mus musculus paired-box transcription factor (Pax4) mRNA, complete cds. XX KW. XX OS Mus musculus (house mouse) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus. XX RN [1] RP 1-1379 RA Inoue H., Nomiyama J., Nakai K., Matsutani A., Tanizawa Y., Oka Y.; RT Isolation of full-length cDNA of mouse PAX4 gene and identification of its RT human homologue; RL Biochem. Biophys. Res. Commun. 243:628-633(1998). XX RN [2] RP 1-1379 RA Inoue H., Nomiyama J., Nakai K., Tanizawa Y., Oka Y.; RT ; RL Submitted (23-OCT-1997) to the EMBL/GenBank/DDBJ databases. RL Third Dept. of Int. Med., Yamaguchi University, 1144 Kogushi, Ube, RL Yamaguchi 755, Japan XX FH Key Location/Qualifiers … formáty sekvencí - EMBL

12 … FH Key Location/Qualifiers FH FT source 1..1379 FT /db_xref=taxon:10090 FT /organism=Mus musculus FT /cell_line=MIN6 FT CDS 297..1346 FT /codon_start=1 FT /gene=Pax4 FT /product=paired-box transcription factor FT /protein_id=AAC40046.1 FT /translation=MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISR FT SLKVSNGCVSKILGRYYRTGVLEPKCIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQ FT HQLCTEGLCTQDKAPSVSSINRVLRALQEDQSLHWTQLRSPAVLAPVLPSPHSNCGAPR FT GPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVARGKLAAATSLPEDTVRVWFSNRR FT AKWRRQEKLKWEAQLPGASQDLTVPKNSPGIISAQQSPGSVPSAALPVLEPLSPSFCQL FT CCGTAPGRCSSDTSSQAYLQPYWDCQSLLPVASSSYVEFAWPCLTTHPVHHLIGGPGQV FT PSTHCSNWP XX SQ Sequence 1379 BP; 327 A; 402 C; 347 G; 303 T; 0 other; aaaaaaaaaa aaaaagcggc cgctgaattc tagcagaagg ctgccctctg ctcctgagtg 60 aaggctctgt gaagctctgg accccctggc aggactgaag cagctggagg ctgttacaag 120 accagaccac cagcaaaccc tggagcctgc acaggaccct gagacctctt cctggaattc 180 ccaccttttt tcctccatcc agaaccagtc ccaaagagaa acttccagaa ggagctctcc 240 gttttcagtt tgccagttgg cttcctgtcc ttctgtgagg agtaccagtg tgaagcatgc 300 agcaggacgg actcagcagt gtgaatcagc tagggggact ctttgtgaat ggccggcccc 360 … gctgtgggac agcaccaggc agatgttcca gtgacacctc atcccaggcc tatctccaac 1200 cctactggga ctgccaatcc ctccttcctg tggcttcctc ctcatatgtg gaatttgcct 1260 ggccctgcct caccacccat cctgtgcatc atctgattgg aggcccagga caagtgccat 1320 caacccattg ctcaaactgg ccataagagg cctctatttg acagtaataa aaacctttt 1379 // EMBL (formát databáze EMBL) formáty sekvencí - EMBL

13 Genbank LOCUS AF145233 1360 bp mRNA ROD 23-OCT-1999 DEFINITION Mus musculus transcription factor PAX4 (Pax4) mRNA, complete cds. ACCESSION AF145233 VERSION AF145233.1 GI:6102607 KEYWORDS. SOURCE house mouse. ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus. REFERENCE 1 (bases 1 to 1360) AUTHORS Kalousova,A., Benes,V., Paces,J., Paces,V. and Kozmik,Z. TITLE DNA binding and transactivating properties of the paired and homeobox protein Pax4 JOURNAL Biochem. Biophys. Res. Commun. 259 (3), 510-518 (1999) MEDLINE 99294619 PUBMED 10364449 REFERENCE 2 (bases 1 to 1360) AUTHORS Kalousova,A., Paces,J. and Kozmik,Z. TITLE Direct Submission JOURNAL Submitted (23-APR-1999) Dept. of Transcription Regulation, Institute of Molecular Genetics, Videnska 1083, Prague 142 20, Czech Republic FEATURES Location/Qualifiers source 1..1360 /organism="Mus musculus" /db_xref="taxon:10090" gene 1..1360 /gene="Pax4" CDS 211..1260 /gene="Pax4" /note="DNA binding protein; paired box protein; homeobox protein" /codon_start=1 /product="transcription factor PAX4" /protein_id="AAF03533.1" … formáty sekvencí - GenBank

14 CDS 211..1260 /gene="Pax4" /note="DNA binding protein; paired box protein; homeobox protein" /codon_start=1 /product="transcription factor PAX4" /protein_id="AAF03533.1" /db_xref="GI:6102608" /translation="MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDIS RSLKVSNGCVSKILGRYYRTGVLEPKCIGGSKPRLATPAVVARIAQLKDEYPALFAWE IQHQLCTEGLCTQDKAPSVSSINRVLRALQEDQSLHWTQLRSPAVLAPVLPSPHSNCG APRGPHPGTSHRNRTIFSPGQAEALEKEFQRGQYPDSVARGKLAAATSLPEDTVRVWF SNRRAKWRRQEKLKWEAQLPGASQDLTVPKNSPGIISAQQSPGSVPSAALPVLEPLSP SFCQLCCGTAPGRCSSDTSSQAYLQPYWDCQSLLPVASSSYVEFAWPCLTTHPVHHLI GGPGQVPSTHCSNWP" BASE COUNT 359 a 381 c 328 g 292 t ORIGIN 1 tggcaggact gaagcagctg gaggctgtta caagaccaga ccaccagcaa accctggagc 61 ctgcacagga ccctgagacc tcttcctgga attcccacct tttttcctcc atccagaacc 121 agtcccaaag agaaacttcc agaaggagct ctccgttttc agtttgccag ttggcttcct 181 gtccttctgt gaggagtacc agtgtgaagc atgcagcagg acggactcag cagtgtgaat … 1081 tccagtgaca cctcatccca ggcctatctc caaccctact gggactgcca atccctcctt 1141 cctgtggctt cctcctcata tgtggaattt gcctggccct gcctcaccac ccatcctgtg 1201 catcatctga ttggaggccc aggacaagtg ccatcaaccc attgctcaaa ctggccataa 1261 gaggcctcta tttgacagta ataaaaacct tttcttagat gttaaaaaaa aaaaaaaaaa 1321 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa // Genbank formáty sekvencí - GenBank


16 ASN Seq-entry ::= set { class nuc-prot, descr { title "Mus musculus transcription factor PAX4 (Pax4) mRNA, complete cds.", source { org { taxname "Mus musculus", common "house mouse", db { { db "taxon", tag id 10090 } }, orgname { name binomial { genus "Mus", species "musculus" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Mus", gcode 1, mgcode 2, div "ROD" } } }, pub { pub { sub { authors { names std formáty sekvencí - ASN

17 Bioinformatic Links

18 GenBank

19 Swiss-Prot

20 Entrez Literature (PubMed) Nucleotide (GenBank) Protein (PIR) Genome Structure (PDB) PopSet Taxonomy OMIM

21 Entrez



24 SRS







31 SRS - list



34 PDB




38 PDB SEQRES 1 A 133 SER HIS SER GLY VAL ASN GLN LEU GLY GLY VAL PHE VAL SEQRES 2 A 133 ASN GLY ARG PRO LEU PRO ASP SER THR ARG GLN ARG ILE SEQRES 3 A 133 VAL GLU LEU ALA HIS SER GLY ALA ARG PRO CYS ASP ILE SEQRES 4 A 133 SER ARG ILE LEU GLN VAL SER ASN GLY CYS VAL SER LYS SEQRES 5 A 133 ILE LEU GLY ARG TYR TYR ALA THR GLY SER ILE ARG PRO SEQRES 6 A 133 ARG ALA ILE GLY GLY SER LYS PRO ARG VAL ALA THR PRO SEQRES 7 A 133 GLU VAL VAL SER LYS ILE ALA GLN TYR LYS GLN GLU CYS SEQRES 8 A 133 PRO SER ILE PHE ALA TRP GLU ILE ARG ASP ARG LEU LEU SEQRES 9 A 133 SER GLU GLY VAL CYS THR ASN ASP ASN ILE PRO SER VAL SEQRES 10 A 133 SER SER ILE ASN ARG VAL LEU ARG ASN LEU ALA SER GLU SEQRES 11 A 133 LYS GLN GLN SEQRES 1 B 26 A A G C A T T T T C A C G SEQRES 2 B 26 C A T G A G T G C A C A G SEQRES 1 C 26 T T C T G T G C A C T C A SEQRES 2 C 26 T G C G T G A A A A T G C FORMUL 4 HOH *84(H2 O1) HELIX 1 1 ASP A 20 HIS A 31 1 12 HELIX 2 2 PRO A 36 LEU A 43 1 8 HELIX 3 3 ASN A 47 THR A 60 1 14 HELIX 4 4 PRO A 78 GLU A 90 1 13 HELIX 5 5 ALA A 96 SER A 105 1 10 HELIX 6 6 VAL A 117 GLU A 130 1 14 SHEET 1 A 2 SER A 3 VAL A 5 0 SHEET 2 A 2 VAL A 11 VAL A 13 -1 N PHE A 12 O GLY A 4 CRYST1 33.840 61.686 171.111 90.00 90.00 90.00 P 21 21 21 4 ORIGX1 1.000000 0.000000 0.000000 0.00000 ORIGX2 0.000000 1.000000 0.000000 0.00000 ORIGX3 0.000000 0.000000 1.000000 0.00000 SCALE1 0.029551 0.000000 0.000000 0.00000 SCALE2 0.000000 0.016211 0.000000 0.00000 SCALE3 0.000000 0.000000 0.005844 0.00000 ATOM 1 N SER A 1 -1.985 -12.356 81.201 1.00 60.11 N ATOM 2 CA SER A 1 -1.709 -12.440 82.636 1.00 60.41 C ATOM 3 C SER A 1 -2.774 -13.282 83.373 1.00 59.35 C ATOM 4 O SER A 1 -3.734 -13.763 82.751 1.00 58.16 O ATOM 5 CB SER A 1 -1.638 -11.029 83.229 1.00 64.08 C ATOM 6 OG SER A 1 -2.862 -10.345 83.045 1.00 69.46 O ATOM 7 H SER A 1 -2.431 -11.538 80.917 1.00 40.00 H ATOM 8 HG SER A 1 -2.887 -9.549 83.596 1.00 40.00 H ATOM 9 N HIS A 2 -2.634 -13.393 84.701 1.00 59.45 N


40 PDBsum





45 FSSP - Fold classification

46 Structural genomics

47 Bioinformatické WWW rozcestníky EBI: Expasy: Pasteur: Lyon: NCBI:

48 EBI

49 ExPASy


51 Pasteur

52 Bioinformatic Links

Download ppt "Jan Pačes Ústav molekulární genetiky Jiří Vondrášek Ústav organické chemie a biochemie"

Similar presentations

Ads by Google