Presentation is loading. Please wait.

Presentation is loading. Please wait.

Figure 1 Renilla Luc Tk pRL-Tk Firefly Luc LexA pL6NLuc NRE pLexA-p65 p65LexA MPSV pLexA-p65 pL6NLuc NRF expression vectors - - NRF(1-380) NRF(1-690) -

Similar presentations


Presentation on theme: "Figure 1 Renilla Luc Tk pRL-Tk Firefly Luc LexA pL6NLuc NRE pLexA-p65 p65LexA MPSV pLexA-p65 pL6NLuc NRF expression vectors - - NRF(1-380) NRF(1-690) -"— Presentation transcript:

1 Figure 1 Renilla Luc Tk pRL-Tk Firefly Luc LexA pL6NLuc NRE pLexA-p65 p65LexA MPSV pLexA-p65 pL6NLuc NRF expression vectors - - NRF(1-380) NRF(1-690)

2 Figure 2 p65 RHD p65 endogenous p65 B NRF(1-380)TAP + p65 NRF(1-380)TAP + p65RHD NRF(1-380)TAP NRF(1-380)TAP + p65 NRF(1-380)TAP + p65RHD total bound p65 bound p50 bound A

3 Control NRF-Strep Spots B spot peptide sequence 1 1 MDELFPLIFPAEPAQ LFPLIFPAEPAQASG LIFPAEPAQASGPYV PAEPAQASGPYVEII RRL A Figure

4 A spot peptide sequence 1 88 HELVGKDC ELVGKDCR LVGKDCRD PHELVGKDC HELVGKDCR ELVGKDCRD HPHELVGKDC PHELVGKDCR HELVGKDCRD 97. peptide length 8 aa 9 aa 10 aa.. Figure 4 NRF-Strep spots peptide length 8-9 aa aa aa aa aa aa aa 15 aa B 81 PPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQ 114

5 Figure Spots NRF-Strep B spot peptide sequence VNRNSGSCLGGDEIF NRNSGSCLGGDEIFL RNSGSCLGGDEIFLL VNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHR 246 A

6 Figure 6 A 274 RPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTY 306 spot peptide sequence RPSDRELSEPMEFQY APSDRELSEPMEFQY RASDRELSEPMEFQY RPADRELSEPMEFQY DRELSEPMEFQYLPD ARELSEPMEFQYLPD DAELSEPMEFQYLPD DRALSEPMEFQYLPD B NRF-Strep spots


Download ppt "Figure 1 Renilla Luc Tk pRL-Tk Firefly Luc LexA pL6NLuc NRE pLexA-p65 p65LexA MPSV pLexA-p65 pL6NLuc NRF expression vectors - - NRF(1-380) NRF(1-690) -"

Similar presentations


Ads by Google