Presentation is loading. Please wait.

Presentation is loading. Please wait.

3 Secretion OM Q 2 P Folding Z IM A S Y R ATP 1 Assembly TUVWX.

Similar presentations


Presentation on theme: "3 Secretion OM Q 2 P Folding Z IM A S Y R ATP 1 Assembly TUVWX."— Presentation transcript:

1 3 Secretion OM Q 2 P Folding Z IM A S Y R ATP 1 Assembly TUVWX

2

3

4 S C R B TypIV piliation (Pil) Protein secretion (Xcp) Q Q PilD Z P
TUVWX S ATP XcpA Q Protein secretion (Xcp) P OM Q PilD IM C B ATP A

5 The pseudopilus hallmarks
Bacteria overproducing XcpT are covered with extracellular pilus-like appendages. Transmission Electron Microscopy, Negative Staining Individual fibrils « Bundled » The pseudopilus hallmarks

6 XcpT is assembled in a multifibrillar structure called
type II pseudopilus TEM analysis, Immunogold labelling anti-XcpT Flagella Type II pseudopilus Type IV pilus

7 Image Filtering Original Image Filtered image Enlargement Fourier
Transform Filtered image Enlargement

8 The Secreton-Dependent Pathway (Type II)
Secretin OM XcpQ P Xcp IM XcpR C ATP ADP + Pi Traffic ATPase

9

10 Molecular Mechanisms involving:
SECRETINS TRAFFIC ATPASES Secretion Type II Type III Type IV Piliation Filamentous phage extrusion DNA uptake/Natural competence Assembly of S-layer proteins Secretion Type II Type IV Type IV Piliation Bacterial Conjugation DNA uptake/Natural competence

11 BfpB Secretin E. coli EPEC
Scmidt et al., J Bacteriol :

12 LES SÉCRÉTINES TRANSPORTENT DE LARGES COMPLEXES
(12-14 subunits) YscC PilQ XcpQ pIV Inner diameter (nm) 5 5-6 9-10 8 Outer diameter (nm) 20 18 19-20 14 Process Type III Secretion Type IV pili Type II Secretion Filamentous phages Bitter & Tommassen, 1999, Trends in Microbiol., 7: 4-7

13 PAO1 GENOME SEQUENCE Stover et al., 2000, Nature, 406: 959-964
Traffic ATPase Secretin

14 Traffic ATPases Secretins Mb W U P V T X Y Z Q R S hxcR hxcQ 1 1 xqhB
hxcR hxcQ 1 1 xqhB pscC Type III secretion 2 2 xqhA Type II secretion 3 hplR 3 xcpR Type II secretion xcpQ Type II secretion 4 4 pilT/pilU Type IV piliation hvbA xqhC 5 5 pilB Type IV piliation pilQ Type IV piliation hxrA 6 6 6,3 6,3

15 P. aeruginosa hxc gene cluster
ApR W U P V T X Y Z Q R S hxc xcp WT xcp hxc 94 kDa 67 43 30 20 (Supernatant fraction, Phosphate starvation) Mass Spectrometry

16 Low molecular weight Alkaline Phosphatase
LapA (368) MFKRSLIAASLSVAALVSAQAMA-VTGGGASLPAELYK Tan & Worobec, 1993 lapB LapB (370) MLKPMFGVVALTLLTSHTTLG-ATVTGGGASMPAKLYK phxcV-lacZ phxcT-lacZ lapA hxc gene cluster

17 Identification of a second xcp-like gene cluster involved in type II secretion
Hxc system is specifically involved in secretion of low molecular weight alkaline phosphatases Expression of the hxc gene cluster appeared to be coregulated with lap genes expression

18 Which alternative systems can assemble the type II pseudopilus ?
Q Pil system (type IV pili) pil A B C Prepilin peptidase xcpA/pilD Pilin Xcp system (type II secreton) xcp Z Y X W V U T S R P Q ATP fixation motif Pseudopilins Secretin Hxc system (type II secreton) hxc W U P V T X Y Z Q R S

19 xcpRS/hxcR/pilQ - - - No
Requirement for the Xcp, Hxc or Pil system in the assembly of the type II pseudopilus STRAINS MOLECULAR MACHINERIES PSEUDOPILUS ASSEMBLY Xcp Hxc Pil WT Yes xcpZ-Q Yes xcpA No pilQ/hxcR Yes xcpRS/pilQ Yes xcpRS/hxcR Yes xcpRS/hxcR/pilQ No

20 Traffic ATPases Secretins Mb hxcR hxcQ 1 1 xqhB pscC 2 2 xqhA 3 hplR 3
hxcR hxcQ 1 1 xqhB pscC Type III secretion 2 2 xqhA Type II secretion 3 hplR 3 xcpR Type II secretion xcpQ Type II secretion 4 4 pilT/pilU Type IV piliation hvbA xqhC 5 5 pilB Type IV piliation pilQ Type IV piliation hxrA 6 6 6,3 6,3

21 A flp / tad gene cluster in the P. aeruginosa genome
Secretin Traffic ATPase Actinobacillus actynomycetemcomitans Kachlany S.C. et al., (2000), J. Bact., Secretin Traffic ATPase

22 A. actinomycetemcomitans adherence system: ( electron microscopy)
the « Flp pili » Kachlany S.C. et al., (2001), Molecular microbiology, 40, - Gram-negative cocobacillus, agent of the juvenil periodontal disease - Produces long fibrils of bundled pili responsible for non-specific adherence and autoaggregation - Forms a tenacious biofilm on teeth - Structural subunit of bundled pili is encoding by flp-1 gene. tad genes cluster encodes the assembly machinery of Flp pili - Flp-1 is a member of the type IVB pilus sub-familly A. actinomycetem- comitans (negativ contrast) Bundled pili ( electron microscopy)

23 Phylogeny of genes for secretion NTPases: Development of a diagnostic
key for gene classification Planet et al., Proc. Natl. Acad. Sci. USA, 2001, 98,

24 The Secreton-Dependent Pathway (Type II)
ETA SP Sec OM XcpQ P Xcp Tat IM XcpR C ATP ADP + Pi

25 The P. aeruginosa Tat system
E. coli P. aeruginosa Amino acid identity (%) in corresponding proteins 39 30 44 57 tatA tatC hisE tatD tatE tatB PA5071 KmR Is the system functional ?

26 Viability of E. coli and P. aeruginosa strains upon pfColA production
The colicin A assay OM IM OmpF BtuB PAL Tol pfColA Colicin A ( A B Tat RR Sec SP  Viability of E. coli and P. aeruginosa strains upon pfColA production E. coli  P. aeruginosa WT WT (cai)a tatA-E tatC tatC (pTATC) pMMB67EH + pRR-pfColA67 -

27 The P. aeruginosa Tat substrates ?
PAK-TC PAK 94 67 43 30 20 PAK PAK-TC PAKDxcpRZ Mass spectrometry MISKSRRSFIRLAAGTVGATVATSMLPSSIQAALAI PlcN 35 aa Phospholipases C MTENWKFRRRTFLKHGAQAATLAGLSGLFPETLRRALAV PlcH 38 aa

28 Phospholipase C activity* in cell fractions
4.21 0.57 0.68 Cytoplasmic membrane 0.04 <0.01 0.01 PAK-TC (tatC) 0.16 4.74 0.03 PAK-∆xcpRZ 0.10 0.50 2.80 PAK Wild-type Cytoplasm Periplasm Supernatant Strain * p-nitrophenyl-phosphatidylcholine as substrate

29 The Secreton-Dependent Pathway (Type II)
ETA SP Sec Plc’s RR Tat OM XcpQ P Xcp IM XcpR C ATP ADP + Pi


Download ppt "3 Secretion OM Q 2 P Folding Z IM A S Y R ATP 1 Assembly TUVWX."

Similar presentations


Ads by Google